KEGG   Burkholderia pseudomallei BPC006: BPC006_I3605Help
Entry
BPC006_I3605      CDS       T02301                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00471  D-Glutamine and D-glutamate metabolism
bpq00550  Peptidoglycan biosynthesis
bpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BPC006_I3605
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BPC006_I3605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bpq01011]
    BPC006_I3605
Enzymes [BR:bpq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BPC006_I3605
Peptidoglycan biosynthesis and degradation proteins [BR:bpq01011]
 Precursor biosynthesis
  Amino acid ligase
   BPC006_I3605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFR17449
Position
I:complement(3484483..3485997)
Genome map
AA seq 504 aa AA seqDB search
MFGDRQRPMVLVLGLGESGLAIARWCARHGCRLRVADTRETPPNLAALTAAGVDFEFVGG
AFSPALVDGGIELVALSPGLSPLAEDLAPLVAAARERGIPVWGELEFFAQALAALGANGY
APKVIAITGTNGKTTTTSLAGLLCERAGKKVAVAGNISPAMLDKLTEAIDAAALPDVWVL
ELSSFQLDTAHTFAPDAATILNITQDHLDWHGGFAAYAAAKGRVFGPRTVRVLNRDDAEV
MRFAPPAAAADAPRAVTFGLNEPAADGDYGLLRENGIAWLVEAIDRDGADAPAAPSRRRK
QEAANPPDIALKRLMPADALRIRGLHNAANALAAYALARAIGLPAAPLLHGLREYRGEPH
RVEVIATLDGVDYVDDSKGTNVGATVAALDGLAQRAVLIAGGDGKGQDFEPLAAPVARWC
RAVMLIGRDAPALREALADTGVPLADHATLEAAVRAASALAQPGDAVLLSPACASLDMFR
NYAHRADVFRSAVEDIALEKGTTL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgttcggagatcggcagcggccgatggtgctcgtgctggggctcggcgaatcgggcctc
gcgatcgcgcggtggtgcgcgaggcacgggtgccggttgcgcgtcgccgatacgcgcgag
acgccgcccaacctggccgcgctgacggcggcgggcgtcgatttcgaattcgtcggcggc
gcgttttcgccggcgctcgtcgacggcgggatcgaactcgtcgcgctgagccccggcctg
tcgccgctcgcggaggatctcgcgccgctcgtcgccgccgcacgcgagcgcggcattccc
gtgtggggcgagctcgaattcttcgcgcaggcgctcgcggcgctcggcgcgaacggctac
gcgccgaaggtgatcgcgatcaccggcacgaacggcaagacgacgacgacgagcctcgcg
ggcctgctgtgcgagcgcgcgggcaagaaggtcgcggtcgcgggcaacatcagcccggcg
atgctcgacaagctgaccgaagcgatcgacgcggcggcgctgccggacgtgtgggtgctc
gagctgtcgagctttcagctcgacaccgcgcacacgttcgcgcccgatgcggcaacgatc
ctcaacatcacgcaggaccatctcgactggcacggcggcttcgccgcgtatgcggccgcg
aagggccgcgtcttcgggccgcgcacggtgcgcgtgctcaatcgcgacgatgccgaggtg
atgcgcttcgcgccgcccgccgcggccgccgacgcgccgcgcgcggtcacgttcggcctg
aacgagccggccgccgacggcgattacggcctgctgcgcgaaaacggcatcgcatggctc
gtcgaggcgatcgatcgcgacggggccgatgcgcccgccgcgccgtcacgccggcgcaag
caggaggcggcgaatccgcccgacatcgcgctcaagcggctgatgcccgccgacgcgttg
cgcatccgcgggctgcacaacgcggcgaacgcgctcgccgcctatgcgctcgcgcgcgcg
atcggcctgccggccgcgcctctcctgcacggcttgcgcgaataccgcggcgagccgcac
cgcgtcgaagtgatcgcgacgctcgacggcgtcgactatgtcgacgacagcaagggcacg
aacgtcggcgcgacggtcgcggcgctcgacggcctcgcgcagcgtgcggtgctgatcgcg
ggcggcgacggcaaggggcaggatttcgagccgctcgcggcgcccgtcgcgcgctggtgc
cgcgcggtgatgctgatcggccgcgacgcgcccgcgttgcgcgaggcgcttgccgacacg
ggcgtgccgcttgccgatcacgcgacgctcgaagccgcggtgcgcgcggcgagcgcgctc
gcgcagccgggggacgcggtgctgctgtcgcccgcgtgcgcgagcctcgacatgttccgc
aattacgcacaccgggccgacgtgttccgcagcgcggtcgaagatatcgccttggaaaaa
ggaacgacgctatga

DBGET integrated database retrieval system