KEGG   Burkholderia pseudomallei BPC006: BPC006_I4108Help
Entry
BPC006_I4108      CDS       T02301                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00360  Phenylalanine metabolism
bpq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpq00790  Folate biosynthesis
bpq01100  Metabolic pathways
bpq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BPC006_I4108
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BPC006_I4108
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BPC006_I4108
Enzymes [BR:bpq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BPC006_I4108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AFR17930
Position
I:3993263..3994156
Genome map
AA seq 297 aa AA seqDB search
MSTVVTAKLKEQFDAGLETRADFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFI
EGLARIGLAPDRVPSFADVNRRLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTV
EFGLIRDTRGENGLRIYGAGIVSSKGETLYSLESASPNRIGFDLERVMRTRYRIDTFQKT
YFVIDDFAQLFALADLDARALAARLAGAPEHAAGAVLDGDHVLTRGTGEGWAADADA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccacggtcgttaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgc
gccgatttcaccatcgatcagccgctcgcccgttacggcgacgtcgaccacgcggtgtgg
acgcagttgtatacgcggcaggcggcgctgctgcgcggccgtgcatgcgacgcgttcatc
gagggcctcgcgcgcatcggcctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaac
cggcggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggac
gccgttttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgccgc
ccggaccagctcgattatctacaggagccggactgcttccacgatctgttcggccacgtg
ccgctgctgatcgatcccgtattcgccgactacatgcacgcatacggccgcgcggcgctt
cgcgtcgccgacgacgcaagcgcgctcgcgctccttgcgcgcctctattggtatacggtc
gaattcggcctgattcgcgacacgcgcggcgaaaacgggctgcggatctacggcgcgggc
atcgtgtcgagcaagggcgaaacgctctacagcctcgaaagcgcgtcgccgaaccggatc
ggcttcgatctcgaacgcgtgatgcggacccgataccggatcgacacgttccagaagacc
tacttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacctcgacgcgcgcgcg
ctcgccgcgcggctcgccggcgcgcccgagcacgcggcgggcgcggtgcttgacggcgat
catgtgctcacgcgcggcaccggtgaaggctgggcagccgatgcagacgcttga

DBGET integrated database retrieval system