KEGG   Burkholderia pseudomallei BPC006: BPC006_II0103
Entry
BPC006_II0103     CDS       T02301                                 

Definition
(GenBank) Type V secretory pathway, adhesin AidA
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB
Motif
Pfam: DUF3274 Thioesterase DUF2974 PGAP1 YbjQ_1
Other DBs
NCBI-ProteinID: AFR18043
Position
II:91153..93393
AA seq 746 aa
MNGINDQCFTAARGAGVTMANRPGDRPVPIPRDLPGVVIFIHGVNDPGAAYATVERGLCQ
GLNERLSRSDLRPGAYGRRYAAASAAKAEGDSVRYAEVLGDPDMYLYQRAETGGTHSMFL
PFYWGYRASDDEIAKISHPGEVKSRVADSDGNLMTRGQYQDIHGNRLDAHFGKGGGFFAN
ATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPERRYFVLAAARLANLIKTIRTI
QPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLRQQGQRCVDCIIMVDTPYSLQFT
QDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSAHSCGRAGQNWSKTQGKRPDK
GGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTFGVPDEVPADGAAASRGKTMPA
MTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPARVPVRDPFQRLTPGPDTDGTMLG
TLVESGKNMALQASFKRNDIRFINGEQLKPAYEPDLYGGEVQKGGQVPGHADVAGLMRPD
DVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQAFNRGRPVDEQSHNWRIVPSRSLGS
MLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQLEANNYHSGVLLSSENHRWVTAMDV
AIGQAVTLDDPDWRQLLLLMADWKMTPDVYRNIQKCKNFERLDEHTREFVKACVDYYKTG
RFPDEKYVPLTMPPLVTSELKVESKT
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgaacggaatcaacgatcagtgtttcaccgccgcccgcggggcgggcgtgacgatggcg
aatcggcccggcgaccggcccgtgccgattccgcgcgatctgccgggcgtggtgatcttc
atccacggcgtcaacgatcccggggcggcttatgccaccgtggagcgcgggctgtgccag
gggctcaatgagcgcttgtcgcgaagcgatctgcggccgggggcgtatggcaggcggtat
gcggctgcgtcggcggcgaaagccgagggcgatagcgttcggtatgcggaagtgctgggc
gatccggacatgtatctgtatcaacgtgcggagaccggcggtactcacagcatgttcctg
ccgttctactggggctatcgggcgtccgatgacgagatcgcgaagatcagccatccgggc
gaggtcaagagccgcgtggcggacagcgacggcaacctgatgacgcgcggccagtatcag
gacatccacggcaaccggctcgacgcccatttcggcaagggcggcgggtttttcgccaac
gcgacgaacaacatcccgcagatgtacagcccgggcttcgaaccggacaagctcgagcgc
acggtcatgcaaaacgcgctggccggcaatacgatcttcgccggcaagtcgcccgagcgc
cgttacttcgtgctggccgcggctcgcctggcgaatctcatcaagaccattcggaccatt
cagccctccgcgctcgcgctcgaacatggaatggaccctcagcacgaaacgatcacggtg
atggggcacagccagggcacgatcatcacgctgctcgcgcaggcgatgctcaggcagcaa
gggcagcgctgcgtcgattgcatcatcatggtcgatacgccgtacagcctgcagttcacc
caggacggcagccagcaaaccgggcacgcgaagctcaagacgctggtcgacatcgtcaac
gcggtgacgagcgagccgcatacgattccggagctggccgaactgatgatcgattcggcc
cattcgtgcggccgggccggacagaactggagcaagacgcagggaaagcggccggacaag
ggcggcaagcactggatcacgttcgacgagcgcgacaaccgcggcaaggtctatctgtac
ttttgcccggaagataccgtggtcggcctcgacaaggtgcgggggatcggcacgttcggc
gtgcccgacgaggtgccggccgatggcgcggcggccagccggggcaaaacgatgcccgcg
atgacggtgcttgagccgaagcgcttctttcagcgcatgtggacgcggctcgagcgcgac
caggacggcagggggaagcgctcgaaggtcgccgtcggcacgccgcccgcgcgcgtgccg
gttcgcgacccgtttcagcgattgacgccgggccccgacacggacggcacgatgcttggc
accttggtcgaatccggcaagaacatggcgctgcaggcatcgttcaagcgcaacgacatt
cgcttcatcaacggcgagcaactgaaaccggcgtacgagcccgatctgtacgggggcgag
gttcagaagggcggacaggtgcccgggcacgccgatgtcgccgggttgatgcgtccggac
gacgtgacgaaaaacgtcgcgctcggcaaccagtacgcgaagttcaaatggaaagacgtc
gcgacgacggacgatccgggcgccggcatcgagccgcacaagcaggcattcaatcgcggc
cgtccggtcgacgagcagtcgcataactggcgcatcgtgccgagccggtcgctcggctcg
atgctgtcggcggccgccacgggcggacggtatcagacgtacgtgatccagcgcgaggag
acgccggacgaggttcgcaagcgcatgcgtaccgatgccgatcaactggaagcgaacaac
tatcattcgggcgtactgctcagttcggagaaccatcgctgggtcacggcgatggatgtg
gcgatcggtcaggcggtgacgctggatgatccggactggcggcagttgttgcttttgatg
gcggattggaagatgacgccggacgtgtatcgcaatatccagaaatgcaagaactttgag
cgcttggacgaacacacgcgcgaattcgtgaaagcgtgtgtcgactactacaagacgggc
cgatttcccgacgagaagtatgtacctctcaccatgccaccgctcgtgaccagcgaactg
aaggttgagagcaaaacatga

DBGET integrated database retrieval system