KEGG   Burkholderia pseudomallei BPC006: BPC006_II0128
Entry
BPC006_II0128     CDS       T02301                                 

Definition
(GenBank) OmpA family protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB
Motif
Pfam: OmpA CODH_A_N
Other DBs
NCBI-ProteinID: AFR18068
Position
II:114527..116155
AA seq 542 aa
MVLASLCLPLRMQLDWSHVLTIVLIIAAIVLAIEIFEHSRETAQDRAAEAEIDDHELAVI
IVAGPHASSLFNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLV
SESDDESDMRQAFAKWRTELREALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAI
EIGTRQMNAASKVGELLASIRQQLLRPSPTGSSAQCALGLGVFDWLDATALLSSMTMLAN
TPPFMLKGLTLADVGRRPIRPGAWTRWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIR
EGWSSARHLVSTRASFVPALVFSTVSTLGIAVAVSGWMNCRMIQRVSNDIADYRSGADEW
IGRKRFAQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKLDTVLDSPRTASIAMQL
DTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQLSEARA
RAIRDWFVDQGVLKTRFIVQGAGDTHPIADNDSPSGRAQNRRVEVLLIPDVASDRKASGT
EL
NT seq 1629 nt   +upstreamnt  +downstreamnt
gtggtgctcgcgagcctttgcctgccgttgcgcatgcagctggattggtctcatgtgctg
accatcgttctgatcattgccgccatcgtgctggcgatcgaaatattcgaacactctcgc
gagacagcgcaagaccgagcggccgaagccgaaatcgacgatcacgagctggcggtgatc
atcgtcgcgggccctcacgcatcgtcgcttttcaatagcagcggggacgatacggcgttt
cggcgcgaagccggcgcgttatggctgcgcgccgacagcgtcgagcaattgcgagacacg
atgatgcgcgtcaaggcgtcgcgcggacggttcccggacgccgccgtggtgccgctcgta
tcggaaagcgatgacgaaagcgacatgaggcaggcgttcgcgaagtggcgaaccgaactc
cgcgaagcgctttgctatcccgatgcggcctatgtcctgccttgctatctcgccgtctac
acgtgtcttggattcaagggagccgacggcgcgcgtccgaagtggacgggcgatgcaata
gaaatcggcacgaggcagatgaatgccgcatcgaaagtgggcgagctgctcgcatcgatt
cgacaacaactgcttcggccgtcgcccaccggttcgtcggcgcagtgcgcgctggggctc
ggcgtgttcgattggctcgacgccacggcgctgctgtcgtcgatgaccatgctggcgaat
accccgccattcatgctgaaagggttgacgctcgcggatgtcggcagacggccgatacgt
ccgggagcgtggacgcgctggctcactgttcggaccggtctccatattcgccagaccaaa
tcgtcgatggcgccgcttcccgtgccgcgcgtggcgaagcatgccgaaagcggcattcgg
gaaggatggagcagcgcgcgccatctcgtttccactcgtgcgagcttcgtgccggcgctc
gtgttctccactgtttcgacgctgggcatcgccgtggcggtctcgggctggatgaactgc
cgcatgatccagcgggtgtcgaacgatatcgcggattatcggagcggagccgacgagtgg
atcgggaggaagcgctttgcgcaggcccgcctcgaacacgatcgcacggcgatcgtgcag
acgctgctcgatggcgtaccgaccggtttcggctggggactctaccgggggcaggagttg
ctggtcaagctcgatacggtgctggattcgccgcgcacggcgtcgatcgcgatgcagctc
gacacggtatcgctgttcgccgcgggcaaggctacattttctccgggcgccgcgcagcgt
gagttgcaacatgcattgcggatgattctcgccaatccggaacaacgtgtgctgatcgtc
ggtcatgcagacagctccggctcggatgcggccaattttcagttatccgaagcgcgtgcg
cgcgcgattcgtgactggttcgtcgatcaaggcgtgctgaagacgcgcttcatcgtgcaa
ggagccggcgatacgcatccgatcgccgataacgacagcccttcgggacgtgcgcagaat
cgccgtgtcgaggtcttgctgattccggacgttgcttccgacaggaaggcgagcggtacg
gaactatag

DBGET integrated database retrieval system