KEGG   Burkholderia pseudomallei BPC006: BPC006_II0134
Entry
BPC006_II0134     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0134
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0134
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFR18074
Position
II:119966..121324
AA seq 452 aa
MIAMSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSF
GKLVFKSGAGIFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQ
AGSLARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHAD
GSVALYDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVAD
YLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFVRPQTRRPRPTPGYDHAQ
LYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLVLAVGAQM
SPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGP
FWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgattgcgatgagttggcataacaaagtggtgtggaacgaaggactgtttcttcttccc
cagctgtttcaacaacaggaacggtatttcgaatatttcgcgcacaagcgggccgcggtc
ctcagcccgtttttctggggattcagccgatacgaaatcgatcaggagtcgctatcgttc
ggcaagctcgtgttcaagagcggtgcgggaatatttcccgacggaacgccgttcgacgtg
ccggggcacacgccgccgccgccgccgctgacgatcgccgccgagcatcaggatcaggtg
atttatctcgcggtgccgctgcgtctaccgaatacggaggagaccgcgttcgacgaacaa
gcgggatcgcttgcgcgctattcggcgttcgagatcgaattgcgcgacagcaatgcgatc
ggtcaagggcccaagccggtacagctcgcgaacatgcggctgcgcctgctgccggaaaag
gagctgacgcagtcctggatcggtattgccttgacgcgcgtgaagacgcttcacgccgac
ggctcggtcgcgctgtacgacggtgaccacatcccgcccgtcagccagtacggagcgaac
ccgctgctgcgcgaatgggcgacccagttgcacggcctcgcgaaactgcgagccgacgcg
ctggcgacgcgcctgtccggcagcgatggccgggccggggcggcggccgaggtggcggat
tatttgttgctgcaggtgctgaaccggtatgaaccgctgctcgagcacatctgcaggatt
cgcgaaatgccgcccgtcacgctctatcgcgagctgtcgatgctggcaggcgaattgtcg
acgttcgtgcgcccgcaaacgcgccgtccgcggccgacgcccggttacgatcatgcgcag
ttgtatgcgagcattcgcccgctggtcgacgaggtgcactacctgttgaaccaggttctg
attcgaggcgcgcagccgatcccgctcaccgagcagccgcacggcattcgcgtggccacg
atgttgccgtcggaactcgcgggctattcgagcctcgtgctcgccgtgggcgcgcaaatg
tcgccggacgtgttgcagcagcagttcgcatcccaaacgaagatcagccatccgcagcgg
ctgccggagctcattcgctctcatttgccgggcatgacgatgattccgttgccggtgcct
ccgcggcagattccgttcaattccagctatatctattacgagctatcccgcacggggccg
ttctgggaacagattgcgcaacaaggcgggctggcgatgcacatcgcgggccacttccct
gaactcaagctcgaactttggggagtgcgtcacaaatga

DBGET integrated database retrieval system