KEGG   Burkholderia pseudomallei BPC006: BPC006_II0135
Entry
BPC006_II0135     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPC006_II0135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0135
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0135
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AFR18075
Position
II:121321..122622
AA seq 433 aa
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAA
ANPLLEAATPLLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVR
YCLCTALDEAANRTRWGGGGVWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILE
ILYRVLGLGFEGRYSVVADGRRHLEQIRQRLWTLITGARDAIQPELSLRWRGAEPGRLPL
LRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARILAIAKDEPAPPPQRLRLSILL
KNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREVARVGGRVTVT
GHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaattcgggcgcctttgacgaagccgcgttcgattttctcgtatcggacgaaggcgga
gcgaacgtcgcggccgatcgcgcgcgatcggccgcgaaggccgcgggcgcggagccggcg
cgcgatcggatcgacgcgtcggtcaacgtccagcatcgcctcgacgaagttcgcgcggcg
gccaatccgctgctcgaagccgcgacgcctttgctgcggatgctggcggacatgcctgcg
acgctagacacctccgaagccgtcgcgagccttcgcacgctgctcgtgcgagaggtcgcg
ctgttccagaacttgtgcgagaaggccgatttgccttggaagcacatggcggtcgtgcgt
tattgcctgtgcacggcactggacgaggcggccaatcgcacgcgctggggcggcggcggc
gtatgggcttcgcagagcttgctgattacatacgaaggcgaggtcgacggaggcgagaag
ttcttcctgttgatcggacgcatggcgacggatcctcaggagtacgtcgatattctcgag
attctctatcgcgtgctgggtctcgggttcgaagggcgctacagcgtcgttgcggacggc
cggcggcatctcgagcagattcgccagcgtttgtggacgctcatcaccggcgcgcgcgac
gcgattcagccggaattgtcgctgcgctggcgcggagcggagccgggcaggcttccgcta
ttgcgcagcgtgcccgcatgggcgagcggtgcgctcgtcttcctgctgttgttcggtctc
ttcgcgttctatcagtatcggttgctcaccgaacgcaatgcgctcgaggcgcgcatcctg
gcgatcgcgaaggacgagccggcgccgccaccgcagcgtttgcgcctgtcgatcctgctc
aagaacgaaattgcgcgcggtctactgacggtcgacgaagacgataggcgcagcgtggtc
gtgttccgtggcgattcgatgttccgctccggcgagagccgcgtgcttcccgagatcgag
ccggtgctcgacaaggtggcgcgggaagtggcccgcgtcggcggccgggtcacggtcacg
gggcactccgacaaccagccgattcggcgcgccgacatcccgaacaacctcgtgttgtcg
gaaaaacgcgcggcttacgtcgcgcaaatcctggtccagcgaggcactccggccgatcgt
attcgctcggagggccggggcgacgcgcagcccgtcgcggaaaacgcgacgcctgctggc
cgatcccgcaaccgccgcgtcgaaatcgcggtcacgctgtaa

DBGET integrated database retrieval system