KEGG   Burkholderia pseudomallei BPC006: BPC006_II0140
Entry
BPC006_II0140     CDS       T02301                                 

Definition
(GenBank) PAAR motif-containing protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: AFR18080
Position
II:130188..130436
AA seq 82 aa
MGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFINRLPAAF
VGGVTSCGAPIVSGSPDVMIGS
NT seq 249 nt   +upstreamnt  +downstreamnt
gtgggagatgcgatcggacatggcggcgttctcgtcaccggctcaggtgacgtattcatg
aacggcattcccgcgggattcgtcgccggcagcgtcgccgtgtgcgcgctgcatgcgtcc
gcgcaggcggtggtcgccgcatcgggaacggtattcatcaatcgcctcccggctgcgttc
gtcggtggcgtgacgtcgtgcggcgcgccgatcgtttcaggctcgcccgacgtcatgatc
ggctcataa

DBGET integrated database retrieval system