KEGG   Burkholderia pseudomallei BPC006: BPC006_II0146
Entry
BPC006_II0146     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0146
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0146
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AFR18085
Position
II:complement(140338..140856)
AA seq 172 aa
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLD
DEVDARRYPLVSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRP
LAAQPGASYNKLTFEISALVQWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcggcatcctgaaggacggcatcgggccgcctatcttccgtcgctgctcgaccggctg
caagacgacgcgccgcacgcgctcagcgaatcgcccgatgcctatgcgccgagcgccgac
gaaatgcgccgcatcgtgcagcgagacctgagcctgttgctgaacaccagcaatctggac
gacgaggtggacgcccgccgctatccgctcgtgtcggcatctgtcgtcaactatggcgtg
ccgcctttggcgggcagctatctgcacgaccggaaccgggaaacgatcgagcgcctcgtg
cgcaccgcgatcgcccacttcgagccgcgcctcattgcggactccttggcgatcaggccg
ctcgcggcgcaaccgggcgccagctacaacaaattgacgttcgaaatcagcgcgctcgtg
caatggtcgccgtatccgctggagttgcgcatccagagcacgttcgacctcgaattgaat
cgagtcacgctcgagaagacgacgctcaacggaaattga

DBGET integrated database retrieval system