KEGG   Burkholderia pseudomallei BPC006: BPC006_II0228
Entry
BPC006_II0228     CDS       T02301                                 

Definition
(GenBank) SciN protein
  KO
K11906  type VI secretion system protein VasD
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPC006_II0228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0228
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0228
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFR18167
Position
II:complement(226892..227395)
AA seq 167 aa
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYEL
KTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVAAYR
DLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgccgcgtgcgcg
agcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgcgccgcgccc
acggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtctacgagctg
aagaccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccggacaagacc
gtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggcgagcgccgc
gtgatccggcgcgacgccgatccggcggcgggcgcgctcggcgtcgtcgccgcgtaccgc
gatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgggacgccgca
tggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacgcacgcgatc
aggatcaccgaacccggaaaatga

DBGET integrated database retrieval system