KEGG   Burkholderia pseudomallei BPC006: BPC006_II0230Help
Entry
BPC006_II0230     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0230
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFR18169
Position
II:complement(228104..229603)
Genome map
AA seq 499 aa AA seqDB search
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISD
DAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDI
SKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGS
ISKVAASAHTPFISGASPSVLQMESWQELANPRDLTKIFTQNLEYASWNALRNMDDARYI
GLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTNAAYAMGVNINRSFRLYGWC
SLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGFIPLVHRKNTD
HATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLE
GLTVSLRLVAKLPSIKEAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagcaagcccagacggccgccgccggcgtccagccgcaagcggattcggat
ttcgcgcagttgctcgcgcaggagttcaagccgaagacggagcaggcgcgcgaagcggtc
gaatacgcggtgcgcacgctcgccgagcaggcgctcgcgcaatcggcgacgatcagcgac
gatgcatacaagagcatcgccgcgatcatcgcgcagatcgaccataagctatccgaacag
atcaacctgatcctccatcacgcggatttccagaagctcgaatcggcgtggcgcgggctg
catcacctggtgtcgaacaccgagaccgacgagcgtctgaagatccgcttcatggacatc
tcgaaggaagagctgcgccgcacgatgcggcgctacaagggacaatcgtgggaccagagc
ccgctcttcaagcagatctacgaggaggagtacgggcagctcggcggcgagccgtacggc
tgcctcgtcgccgattactacttcgaccacacgccgcccgacgtcgacctgctcggctcg
atctcgaaggtggccgcgtccgcgcacacgccgttcatctccggcgcgtcgccttcggtg
ctgcagatggaatcgtggcaggagctcgcgaacccgcgcgacctgacgaagatcttcacg
caaaacctcgaatacgcgtcatggaacgcgctgcgcaacatggacgacgcgcgctacatc
ggcctcgcgatgccgcgcttcctgtcgcgcctgccgtacggcgtgctgacgaatcccgtc
gacgagttcgacttcgaggaagacacgaacggcgccgaccatcgccgctacgcgtggacg
aacgccgcctacgcgatgggcgtgaacatcaaccggtcgttccggctctacggctggtgc
tcgctcattcgcggcgtcgaatcgggcggcacggtcgagaacctgccgtgccatacgttc
ccgaccgacgacggcggcatcgacatcaaatgcccaaccgagatcgcgatctcggaccgg
cgcgaggcggagctgtcgaagaacggcttcattccgctcgtgcaccgcaagaacaccgat
cacgcgacgttcatcggcgcgcaatcgctgcacaagccggccgaatacgacgattccgac
gcgacggccaacgcgaatctgtcggcgcgcctgccgtatctgttcgcatgctcgcgcttc
gcgcactacctgaagtgcatcgtgcgcgacaaggtgggcgccttcaaggagcgcgaggac
atgcagcgctggctgaacgaatggatcatgaactacgtcgacgcggacccggcgaactcg
tcgcaggacacgaaggcgcgccggccgctcgcggccgccgaggtggtcgtcgagcaggcg
cagggcaaccccggctactaccaggcgaagttcttcctgcggccgcatttccagctcgag
ggcctgaccgtgtcgctgcggctcgtcgcgaagctgccgtcgatcaaggaagccgcctga

DBGET integrated database retrieval system