KEGG   Burkholderia pseudomallei BPC006: BPC006_II0234
Entry
BPC006_II0234     CDS       T02301                                 

Definition
(GenBank) ImpE/SciE family protein
  KO
K11898  type VI secretion system protein ImpE
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0234
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   BPC006_II0234
SSDB
Motif
Pfam: ImpE Nic96
Other DBs
NCBI-ProteinID: AFR18173
Position
II:234445..235410
AA seq 321 aa
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQWERA
VGQLQAYARFAAQHAHIAHAYRDLIRAERFRARVMAGHARPGFVFDAPPWIDDLREALRA
QAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFA
DLAGWRLARPGVPLDLVWAPCVLTLADGSVAHGFMPARYPGSELADGSGAPGASAAAHEA
DAHESAVREADALRLGSRTAWRDVGRTGVFALGRKTWSTSAGDAGLFELHACEFGARARA
GAVLGGAAREARGGEAADGCA
NT seq 966 nt   +upstreamnt  +downstreamnt
atgacgacgcccgccttcccggcgccgcccggcgcgcgcacgtcggcccggccgcacgat
acgccgctcgacgcgcggctcgcggctgcgcaagccgcggtgcgcgcccggcccgtcgat
gcggcgagccgttgggcgctgtttcaactgctctgcgtgacgggccagtgggaacgcgcc
gtcgggcagttgcaggcttatgcgcggttcgccgcgcagcacgcgcacatcgcgcacgcc
tatcgcgacctgattcgcgccgagcgctttcgcgcccgcgtgatggcgggccacgcgcgg
ccgggattcgtattcgatgcgccgccgtggatcgacgatctgcgggaagcgttgcgcgcg
caggcggccggcgcgcgcgacgaagccgaccgcgcgcgttcgcgcgcgctcgatcgcgcg
ccgttcgtcgcggggcgcgggccggatgcgccgttcgactggatcgccgacagcgattcg
cgattcgggccggtctgcgaagtcgtgaccgccgggcatgatcgttggctgccgtttgcg
gatctggccggatggcggctcgcgcgcccgggcgtgccgctcgatctggtctgggcgccg
tgcgtgctcacgcttgccgacggcagtgtcgcgcacggcttcatgccggcgcgttacccg
ggctccgaactggccgacgggagcggcgcgccgggcgcctcggcggccgcgcacgaggcc
gatgcgcacgagagcgccgtgcgcgaggccgatgcgttgcggctcggcagccggaccgca
tggcgcgacgtcggccgcaccggcgtgttcgcgctcggccgcaagacctggtcgacgagc
gcgggcgacgccggccttttcgagctgcacgcgtgtgaattcggcgcgcgcgcccgtgcg
ggcgccgtgctcggcggcgcggcgcgcgaagcgcgcggcggggaggcggccgatggatgc
gcatga

DBGET integrated database retrieval system