KEGG   Burkholderia pseudomallei BPC006: BPC006_II0237Help
Entry
BPC006_II0237     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0237
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssG
Motif
Other DBs
NCBI-ProteinID: AFR18176
Position
II:237897..238982
Genome map
AA seq 361 aa AA seqDB search
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFR
LGQQPSLAFAPREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTL
GNFLDIFHHRYLTLLYRAWASAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHA
RLSASPHLVREARNADGLRMTLERYFGVPVTLEENVFHWIAVDPLEHSRLGRPGDASTMA
AGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRLVEWVRAFVGYEFEWELELR
IKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGTARDTRGMRGE
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgacatgacgcaggcggccgttgccgacacggcgctgtcgccgcaagcgctc
gcgcggctgcgcgccgaaccgtggcgctatgggttcctcgcgctgctgcgccgcatcggc
gcggatgcgcgcatcgatccgatcggcaaggcgaggcgcccgcaggcggagccgtttcgc
ctcggccagcagccgagcctcgcgttcgcgccgcgcgagatcgccagcgtcggcgacgcg
aacgggcggctcaaggtgcggctgttcgggctcgggatgctggggccgaacgggccgctg
ccgatccacgtgacggagatcgcgcgcgatcgcgaggagagccggcgcgatccgacgctc
ggcaattttctcgacatcttccatcatcgctatctgacgctgctgtatcgcgcgtgggcg
tcggcgcaggcggcggccggcctcgatcgtccggacgacgaacggttttcgttctacgtc
gcgagcctcgccggccaggatctcgacgaggtcggcgcgcggccgctgcccgcgcacgcg
cggctgtccgcctcgccgcatctggtgcgcgaggcgcgcaacgcggacggcctgcgaatg
acgctcgaacgttacttcggcgtgccggtgacgctggaggaaaacgtatttcactggatc
gccgtcgatccgctcgagcacagccggctcggccggcccggcgacgcatcgacgatggcc
gcgggcgcgctgctcggcgagctggtgccggatcggcagcacaagttccggctcgtgttc
gggccgctcgacatcgacgcctatctgcgcttcacgccgcggggcgaggatctgccgcgg
ctcgtcgaatgggtgcgggcgttcgtcggctacgagttcgagtgggagctcgagttgcgg
atcaagccgaacggcgcgccgcccgccgtgatgggcggcccgcatcaactcggctggtcg
ggctggctcggccgctcgccgtccggcgagccggtgacgggcatgcgtttcgaacccgag
cactatgcgcacgggttcgcgcgcggcacggctcgcgacacgcgcggcatgcgaggtgaa
cgatga

DBGET integrated database retrieval system