KEGG   Burkholderia pseudomallei BPC006: BPC006_II0751Help
Entry
BPC006_II0751     CDS       T02301                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPC006_II0751
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0751
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V
Motif
Other DBs
NCBI-ProteinID: AFR18682
Position
II:748464..750710
Genome map
AA seq 748 aa AA seqDB search
MALSFVVHENLSQEPSYQLDLLSHDPDLDFDALLGSTLSADIDLGEGDIRTFNTHVFGGY
DTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTY
EPREYCVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYL
PDGEESRAIQGREGVQRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPL
EYYDYAAGYREPEQGERLARLRLEAIQAESHTLVGEANARALATGRAFTLIGHPALGRNR
RYYVTNSELTFIQDGPDSTSQGRNVAVKFRALVDDQPFRPLLTTPRPEVPGIQSATVVGP
EMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWGVIAMPRVGQEVLVTY
VDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDDQRGAE
RVMIHAERDMQQTVERNSSTSIAQDLNLSVKGTSTSVVGISISFTGISVSYTGLSVSFTG
VSASFTGVSTSFTGVSTSFTGVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTS
LTGSSNSVTGVSNSMTGISSSWTDVSMSTTGQSQSITGVSLSYTGTSNSMTGTSTSVTGT
STSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTTGSSVSTTGSSVSTTGSSVST
TGFSFSYTGVSYSDTGIDLKKVGMQVKS
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgagcttcgtggtgcacgagaacctgtcgcaggagccgtcgtatcaactggat
ctgctgagccacgatccggatctggacttcgacgcgctgctcggctcgacgctgtcggcc
gacatcgacctgggcgaaggcgacatccggacgttcaacacgcacgtgttcggcggctac
gacacggggcagatgagcgggcaatacacgtacacgctggagctgcgaagctggctgtcg
tttctcgcggagaaccgcaacagccggatcttccagaacatgagcgtgccgcagatcgtc
gagcaggtgttccagggccatcagcgcaacggctaccggttcgagctcgaaggcacgtac
gagccgcgcgagtactgcgtgcagttccaggaaacggatctgaacttcgtgaagcggctg
ctggaggacgaagggatctacttctgggtggagcacgagccggatcgtcatgtggtggtg
atctcggacacgcagcggttcgaggatctgccgctgccgaacgacacgctggagtatctg
ccggacggcgaggagtcgcgcgcgatccaggggcgcgaaggggtgcagcggctgcagcgc
acgcggcggatcaagtcgaacaacgtcgcgctgcgggatttcgactatcacgcgccgtcg
aacaagctcgatagcgacgcgcagcaggtgtcgccgccgaacctcgaagggattccgctc
gagtattacgactatgcggcgggctaccgcgagcccgagcagggcgagcgtctcgcgcgg
ctgcggctcgaggcgattcaggcggagtcacacacgctggtgggcgaggcgaacgcgcgc
gcgctggccacgggccgggcgttcacgttgatcgggcatccggcgctggggcgcaatcgt
cggtactacgtgacgaacagcgagctgacgttcatccaggacggaccggacagcacgtcg
caggggcgcaacgtcgcggtgaagttccgcgcgcttgtcgacgatcagccgtttcggccg
ctgttgacgacgccgcgtcccgaagtgccgggcatccagagcgcgacggtggtgggtccg
gagatgtcggaagtgcataccgacaagctcgggcggattcgcgtgcatttccattgggac
cgctacaagacgaccgaggcggatgcgtcgtgctggatacgcgtgtcgcaggcatgggcg
ggcaagggctggggcgtgatcgcgatgccgcgggtcgggcaggaagtgctcgtcacgtat
gtcgacggcgatctcgatcggccgctcgtgacgggcatcgtctacaacggcgagaacccg
acgccttatgacttgccgaaggacatccgctacacggggctggtgtcgcgttcgatcaag
cgtgcgggcggttatcagaacgcgagtcagatcacgttcgatgaccagcgcggcgcggag
cgcgtgatgatccacgcggagcgcgacatgcagcagacggtcgagcgcaacagctcgacg
tcgatcgcgcaggatttgaacctgtcggtgaagggcacgtcgacgtcggtcgtcggcatc
tcgatcagcttcacgggcatctcggtgtcgtacacggggttgtcggtgagcttcaccggc
gtgtcggcgagcttcacgggcgtgagcacgtcgtttaccggcgtgagcacgagtttcacc
ggcgtgtcgacgtcgtttaccggcgtcgacaccggcttcaagggcgtgtcgacgtcgttt
accggcgtcgataccagcttcaagggtgtgtcgacttcgttcacgggcgtaagcacgagc
ctcaccggttcgagcaactcggtgacgggcgtgtcgaacagcatgacgggcatctcgtca
tcatggaccgacgtcagcatgtcgacgaccggccaatcccaaagcatcacgggggtatcg
ctgtcgtacacgggcacgtcgaacagcatgacgggcacgagcacgtcggtgacgggcacc
tcgacgagcatcaccggcacgtcgatgtcgaacaccggcagctcgacgagcatcacgggc
acgtcgatgtcgacgacgggcagctcgacgagcgtcaccggctcgagcgtatcgacgacc
ggcagctcggtgagcacgacgggctcgagcgtgtcgacaacgggcagcagcgtgtcgacg
acaggtttcagcttctcgtacaccggcgtcagttattcggacaccggtattgacctgaag
aaggtcggcatgcaagtgaagagctga

DBGET integrated database retrieval system