KEGG   Burkholderia pseudomallei BPC006: BPC006_II0752Help
Entry
BPC006_II0752     CDS       T02301                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPC006_II0752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0752
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V DUF4901
Motif
Other DBs
NCBI-ProteinID: AFR18683
Position
II:750876..753164
Genome map
AA seq 762 aa AA seqDB search
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLG
EGDIRTFNTHVFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQ
GHQRNGYRFELEGTYEPREYCVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQ
RFEDLPLPNDTLEYLPDGEESRAIQGREGVQRLQRTRRIKSNNVALRDFDYHAPSKQLDS
DAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAIQADAHALGGEANARALAVGR
AFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQPFRPLLVTKR
PRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIP
NASQLTFDDQHGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTG
ISVSYTGLSVSFTGVSARFTGVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTS
FTGVATSMVGVSTSITGSSNSVTGVSNSMTGISSSWKDVSMSTTGQSESITGVSLSYTGT
SNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSVSTTGSSMSATGSSVGT
TGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgatcgaactgcgcagtcccctgctggacccggacgccgtcgcgctgagcttc
gtggtgcacgagaacctgtcgcaggagccgtcgtatcagctcgatttgctgagccacgat
tcgaatctggacttcgacgcgctgctcggctcgacgctgtcggccgacatcgacctgggc
gaaggcgacatccggacgttcaacacgcacgtgttcggcggctacgacacggggcagatg
agcgggcaatacacgtacacgctggagctgcgaagctggttgtcgtttctcgcggagaac
cgcaacagccggatcttccaggatttgagcgtgccgcagatcgtcgagcaggtgttccag
ggccatcagcgcaacggctaccggttcgagctcgaaggcacgtacgagccgcgcgagtac
tgcgtgcagtttcaggaaacggatctgaacttcgtgaagcggctgctggaggacgaaggg
atctacttctgggtggagcacgagccggaccgtcatgtggtggtgatctcggacacgcag
cggttcgaggatctgccgctgccgaacgacacgctggagtatttgccggacggcgaggag
tcgcgcgcgatccaggggcgcgaaggggtgcagcggctgcagcgcacgcggcggatcaag
tcgaacaacgtcgcgctgcgggatttcgactatcacgcgccgtcgaagcaactggacagc
gacgcgcaggtcgagcagcagagtctcggcggcattccgctcgagtactacgactacgcg
gccggctaccgcgaccccgagcagggcgagcgtctcgcgcggctgcggctcgaagcgatt
caggctgatgcacacgcgctcgggggcgaggcgaacgcacgcgcgctggcggtgggtcgc
gcgttcacgctggtcggccatccggcgctgagccgcaatcgtcggtactacgtgacgaac
agcgagctgacgttcatccaggacggaccggacagcacgtcgcaggggcgcaacgtcgcg
gtgaagttccgcgcgctcgccgacgatcagccgtttcggccgctgctcgtcaccaagcgg
ccgcgcgtgccgggcatccagagcgcgacggtggtgggcccggagatgtcggaggtgcat
accgacaagctcgggcggattcgcgtgcacttccactgggaccgctacaagacgaccgag
gcggacgcgtcgtgctggattcgcgtgacgcaggcatgggcgggcaagggctggggtgtg
ctcgcgatgccgcgggtcgggcaggaagtcatcgtcgtgtatgtcgacggcgatctcgac
cggccgctcgcgacgggcatcgtctacaacggcgaaaacccgacgccttatgacctgccg
aaggatatccgctacacgggcctcgtcacacgctcgatcaagcgggcgggcggcattccg
aatgcgagccaactgacgttcgacgatcagcacggcgcggagcgcgtgatgatccacgcg
gagcgcgacttgcagcagacggtcgagcgcaacagctcgacgtcgatcgcgcaggatttg
aacctgtcggtgaagggcacgtcgacgtcggtcgtcggcatctcggtcagcttcacgggc
atctcggtgtcgtacacggggttgtcggtgagcttcaccggcgtgtcggcgaggttcacg
ggcgtgagcacgtcgtttaccggcgtgagcacgagtttcaccggcgtgtcgacgtcgttt
accggcgtcgataccagcttcaccggcgtctcgaccggattcaagggcgtcgacacgagc
ttcaccggcgtcgcgacgtcgatggtgggcgtgtcgacgagcatcacgggctccagcaat
tccgtgacgggcgtgtcgaacagcatgacgggcatctcgtcttcctggaaggacgtgagc
atgtcgacgaccggccagtccgaaagcatcacgggagtatcgctgtcgtacacgggcacg
tcgaacagcatgacgggcacgagcacgtcggtgacgggcacctcgacgagcatcaccggc
acgtcgatgtcgaacaccggcagctcgacgagcatcacgggcacatcgatgtcgacgacg
ggcagctcggtgagcacgacgggctcgagcatgtcggccaccggcagttcggtgggcacg
acgggctcgagcgtatcgacgacgggaagcaagatgtcggtcaccggcttcagcttctcg
tatacgggagcgagctacgaggatgtgggcgtcgatctgaaaaagctcgggatgcagacg
aagaactga

DBGET integrated database retrieval system