KEGG   Burkholderia pseudomallei BPC006: BPC006_II0757Help
Entry
BPC006_II0757     CDS       T02301                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BPC006_II0757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II0757
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: AFR18688
Position
II:757611..758204
Genome map
AA seq 197 aa AA seqDB search
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQT
CVYVVTAADWLPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVA
DADYARRPANYGPLRVRVEGRGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEP
PPERKTKTTYGTRRSRQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcacaagatgggccccttcaaatcgatcgcggcggcgctcgcgctcggcgtgctc
gccggctgctcggccttctcgtcgtcgaagccggaagagccgcggcagttgcacgtgacg
ctcgtcggcggcgcccggctgaacgtcgcgccgacgggcgagccgcgtccggtgcagacg
tgcgtgtatgtcgtgaccgcggccgactggctgccgacgcagggcggcgacgattcgtcg
tgcgcgtcgcgcgggcaggacagcacggtcgtcgccgactcgcggcacgtgatcgcgccg
aaccagttgctgcagttctcgctgaacctgccgcgctcgggcgagctctggctcgtcgcc
gacgccgactacgcgcgccggccggcgaactacgggccgctgcgcgtgcgcgtcgagggc
cgcggcttgattcacatggctgtctggctggaccgcgacggcatctacaacgcgttgttg
ccggggcccgtgcccgtcggcggcgcgatcgccccggcggcggtccgccccgacgagccg
ccgcccgagcgcaagacgaaaaccacctatgggacaaggagaagcaggcaatga

DBGET integrated database retrieval system