KEGG   Burkholderia pseudomallei BPC006: BPC006_II0954Help
Entry
BPC006_II0954     CDS       T02301                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00250  Alanine, aspartate and glutamate metabolism
bpq01100  Metabolic pathways
bpq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BPC006_II0954
Enzymes [BR:bpq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BPC006_II0954
Peptidases [BR:bpq01002]
 Cysteine Peptidases
  Family C44
   BPC006_II0954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC tRNA_Me_trans DUF2795 DUF3700
Motif
Other DBs
NCBI-ProteinID: AFR18885
Position
II:952057..953955
Genome map
AA seq 632 aa AA seqDB search
MTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLSEHGHQPMLSACGRYAMTFNGEIYN
FRELRGELEREHRAPEWRGHSDSEVLLAAFCAWGVDRALQKAVGMFALALWNRESRVLTL
ARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDAHPIDRDALCLYLRHASVPAPYTIY
EGIRKLPPGTYAQLEDLAEAPAPRRYWSLERAIAAGRANPFDGDANAAVAQLDHVLRDAI
AEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQTFTIGFHEAGYDEAGYAKAVARHL
GTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIPTLLVSELTRRHVKVSLSGDGGDEL
FGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALRPDHADQIASLVQGAWSASAQRDAS
PRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERFTLAGHEPQTLIDTPGAWPAGLSFA
EQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFLDHRVVEFAWRLPEALRIPDGQDKW
LLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSDWAAELLRPARLRDEGYLDAARVER
LWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacggacagtctcgcgcatcgcggcccggacgataccggtttgtggatcgatcacgac
gcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtccgagcacgggcat
cagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggcgagatctacaac
tttcgcgagttgcgcggcgagctcgagcgcgagcatcgcgcgcccgaatggcgcggtcat
tcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgatcgcgcgttgcaa
aaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgcgtgctcacgctc
gcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggcggctcgttcgtg
ttcggctccgagctgaaggcactgcggcgttttcccggcttcgacgcgcatccgatcgac
cgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccgtacacgatctac
gaaggcatccgcaagctgccgcccggcacgtacgcgcagctcgaggacctcgccgaagcg
cccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggccgcgcgaatccg
ttcgacggcgacgcgaacgccgccgtcgcgcagctcgatcacgtgttgcgcgacgcgatc
gccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggcggcgtcgattcg
tcggtgatcgtcgcgctgatgcagacgcagaccgcgcagccggtgcagaccttcacgatc
ggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggttgcgcggcatctg
ggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcgaccgtcccgcgc
atgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccgacgctgctcgtc
tccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggcggtgacgagctg
ttcggcggctacacgcgctatttcctgacgccgcgcctatgggggcggctgcgccgcgtg
ccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcggcccgaccatgcg
gatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcagcgcgacgcgtcg
ccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcggacagccgcgcg
tcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttcacgctcgcgggg
cacgagccgcagacgctgatcgacacgccgggcgcgtggcccgccgggctgtcgttcgcc
gagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatcctgacgaaagtc
gaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctcgatcaccgcgtc
gtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatgggcaggacaagtgg
ttgctgcgcaagctgctgtatcgctacgtgccgcgcccgctgatcgaccggccgaaacag
ggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgactgggcggcggag
ctgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcgcgcgtcgagcgc
ctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctctggacggtgctg
atgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system