KEGG   Burkholderia pseudomallei BPC006: BPC006_II2012Help
Entry
BPC006_II2012     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II2012
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AFR19938
Position
II:2050457..2052199
Genome map
AA seq 580 aa AA seqDB search
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQ
KLDEGLPELVQALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTA
CRFRTCGELDIEPIALAGCRFVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLH
ASRLFALLMQHVVAVEIAGGPPELPGPRCALGARALRPAGFDDALLPCPERAFPGFRLLH
EYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPDWLPGIDRDSFRLNVAAALNL
FAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHYVPFGVAGDDA
NAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTISHLALNFLSLGDADHLKRMLALHAFGE
RGDDARAQADRRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCV
LERFLAEYAAINTYTRVEIDASPDGVRFAWPPRMGAQCLL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccacgcccaatcgctattacgaggacgagctcgttcgcctgcgcgagctc
gccgccgagttcgcccgcgcgcacccgctgctcgcgccgatgctcggcgcgccgtcgggc
gacccggacgtcgagcggctgctcgaaggcgtcgcgttcctgacggggctcgcgcggcaa
aagctcgacgaaggcctgccggagctcgtgcaggcgctcgcgaacctgctgtttccgcac
tcgctgcgcccggtgccggcggccacgctgatcgcgttcgagccgcgcggcgcgctgcgc
gagcgcgcggtgatcgcggccggcaccgagatcgaatcggtgcccgtcgacggcaccgcc
tgccggtttcgcacgtgcggcgagctcgacatcgagccgatcgcgctcgccggctgccgg
ttcgtgccgcccgcgcacggcgggcccgcgctgcggctcgacttcgagatgctcggcctc
gacgcgagcgaatgggacgcgacgcgcattcggctgttcatcggcggcgagcggctgcac
gcaagccgcctgttcgcgctgctgatgcagcacgtcgtagcggtcgagatcgcaggcggc
ccgcccgagctgcccggcccgcgctgcgcgctcggcgcccgcgcgctgcgcccggcgggc
ttcgacgacgcgctgctgccctgccccgagcgggcgttccccggcttccggctgctgcac
gaatatttcgcgttcgccgagaaattcctgttcgtcgagctgggcggcctcgagcgctgg
cgcgcggcgcgcgcgggcgcgcagttcagcgtatggctcgcgctcgacagcgcgcccgac
tggctgcccggcatcgatcgcgacagcttccggctgaacgtcgccgccgcgctgaacctg
ttcgcgcacgaagcggtgccgatccagcacgagcatcgcgcgaccgattaccggctgcag
cccgaaggcgacacgtcgggccactaccggatctactcggtcgaccgcgtgatcggctac
cgccccggccacgcggtcgaccgccattacgtgccgttcggcgtcgcgggcgacgacgcg
aacgccgcgagctaccggctgattcgccgcgccgcgctcgacggccacgggcaggatctc
catctggcgctcgcctacccgcccggcgaggcgctcgccacggaaacgctgtcgatcggc
ctgtcgtgcacgaacggcgcgttgcccgcgcgcctgaagatcggcgacgtgtgccgcgcg
accgacagctcgcccgagcgcttcacgttcgccaacatcgcgcccgtgagcccgccgctc
gatccgccgctcggcgaaccgctgctgtggcgcaccatcagccatctcgcgctgaacttc
ctgtcgctcggcgacgccgatcatctgaagcgcatgctcgcgctccacgcgttcggcgaa
cgcggcgacgacgcgcgcgcgcaagccgaccgccgccgcatcgacggcatcgaatcggtc
gacgtgcgggccgagacgcggatcatcggcgagcggatgctgagcggccagcgcgtggcg
ctgcgctgcagcgcccatgcgttcggcggcgcgggcgagctgtatctgttcggctgcgtg
ctcgagcgctttctggccgaatacgcggcgatcaacacctacacgcgcgtcgagatcgac
gcgtcgcccgacggcgtgcgcttcgcgtggccgccgcgaatgggggcgcaatgcctgctc
tag

DBGET integrated database retrieval system