KEGG   Burkholderia pseudomallei BPC006: BPC006_II2021Help
Entry
BPC006_II2021     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bpq  Burkholderia pseudomallei BPC006
Brite
KEGG Orthology (KO) [BR:bpq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpq02044]
    BPC006_II2021
Secretion system [BR:bpq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BPC006_II2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AFR19947
Position
II:2065020..2066453
Genome map
AA seq 477 aa AA seqDB search
MTHDASRTGTNDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLA
QAAIDRRVVEIRSTRLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARG
ANNVTVAAAPDALPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALA
AHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQLQQYKNP
REMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGELSVFSER
FDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQ
RSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTR
LPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgacgcatcacgaaccggaacgaacgacatggacaacgtctattggcatcag
gggatgctgctgcaaccgcaacattttcagttggccgaactgcaccagcagttccgcttc
gagccgtggctcgcgtgcggcccaccgcatttctggggcgtcggcgcgctgtcgctcgcg
caggccgcgatcgatcgccgcgtggtcgagatccgctcgacgcgcctgctgttcgccgac
cgcagctacgtcgaatatccgggcaacgcggtcgtcgccgcgcgcgcgttcgatcccgcg
tggctcgacgaaggccgcgcgctcgtcgcgcacgtcgcgctcaggcggctcgcgcgcggc
gcgaacaacgtgacggtcgcggccgcgcccgacgcgctgcccgacgccccgacgcgctac
gcgacgctgccgtccgccgaggaggtcgccgatctgcattcggaccatccgggcgcgccg
gtgcgcacgctcaagcacgtgctgaagatcgtgttcgagcacgagctcgacgcgctcgcc
gcgcacgaaacgatcccgatcgcgcggatcgtgcgcgacggcgagcgcctgcggctcgac
gacgatttcgcgccgccctgctacgcgctgtcgggctcgcgcacgctgctcgagcgcgtg
cgctgcattcgcgacgagctcgcgggccgcgcgcggcagttgcagcagtacaagaatccg
cgcgagatgcaacgcgccgaattcgacgcgagctatgcggcgttcctgctcgcgctgcgt
tcgctgaaccgcttcggcccgctgctgttccatctcgccgaatgcgacgggcagcatcca
tggacggtctacggcgtgctgcgccaactcgtcggcgagctgagcgtgttctccgagcgc
ttcgacatgctcggcgagacgcccgatgcgcgcggcggcctgccgccgtacgaccaccgc
gatctgggcggctgcttctcgcgcgcgcacgcgctgatcggccacctgctcgacgaaatc
gcggtgggcccggactgcgtcgcgacgttcgagcccgacggcccgcagcagcccgcgcaa
cgctcggcgcaactgccgcccgacgtgttcgcggatcgccaccagatctatctcgcgatc
cgcagcgcgcacgatccggacacgctcgcgcaacgcttcgcgctcggcggccggatcgcg
gcgaccgacgaaatgccgcagctcaccgcgctcgcgctgccgggcgtcgaactcacccgc
ctgcccggcccgccgccgcggctgccgcgccgcggcgacgcgcgctacttccggatcgag
caggccggccgcccgtgggacgcgatccggcgtgacggccgcgtgtcgctgcgctgggcc
gacgcgccggacgacctgcacgcggaactcgtcgcggtgaggcacacgcaatga

DBGET integrated database retrieval system