KEGG   Burkholderia pseudomallei BPC006: BPC006_II2258Help
Entry
BPC006_II2258     CDS       T02301                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
bpq00040  Pentose and glucuronate interconversions
bpq00052  Galactose metabolism
bpq00500  Starch and sucrose metabolism
bpq00520  Amino sugar and nucleotide sugar metabolism
bpq01100  Metabolic pathways
bpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPC006_II2258
   00052 Galactose metabolism
    BPC006_II2258
   00500 Starch and sucrose metabolism
    BPC006_II2258
   00520 Amino sugar and nucleotide sugar metabolism
    BPC006_II2258
Enzymes [BR:bpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BPC006_II2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFR20184
Position
II:complement(2318334..2319221)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSFEIESELEARGKEKLLELVRGIKPSHVDCFYVRQPAALGLGHAVLCAEK
LVHGEPFAVILADDLLHGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGREWE
EDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLT
EEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLRNCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaagccgtgttccccgttgccggtctcggcacacggtttttgccc
gccacgaaggcgagtccgaaggaaatgctgcccgtggtcgacaagccgctgatccagtac
gcggtcgaagaggcgatcaatgcgggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaagatcacttcgacaaatcgttcgagatcgaatccgagctcgaggcg
cgcggcaaggaaaagctgctcgaactcgtgcgcggcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggccgcgctcggcctcggccacgcggtgctctgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaccag
ccggtgctcaagcagctcgtcgacgtcttcaaccactatcacagctcggtgatcggcgtc
gagacgatcgagcgcgaggacagccgctcgtacggcatcgtcgaaggccgcgagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgcccgagcatgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctgatgccgagcatcttcgagcatctgcgcaag
atcaagccgggcgcgggcggcgaactgcaactgacggacgcggtgcagtcgctgctgacc
gaggagcaggtgctcgcgtaccgctactacggcacccgtttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagctcgcgctgcggcatccggaagtgggccgcgaattc
gaggcgtacctgcgcaactgcctgccggcgctcgccgcggttgcttag

DBGET integrated database retrieval system