KEGG   Burkholderia pseudomallei BPC006: BPC006_II2723
Entry
BPC006_II2723     CDS       T02301                                 

Definition
(GenBank) hypothetical protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB
Other DBs
NCBI-ProteinID: AFR20647
Position
II:2746518..2747423
AA seq 301 aa
MKKYALALWFMLVSSMSAMAGAIIPSGATLVAGQYAISNNGNFAFGVDAASGKLYFHYRF
PTQAWGASAMSQMYGTQPEGALYVGKGDRLVMQTDGRLVFYSGNDVVWSNWYYGPAPIPG
SYAVVEDFGVVAIYPPQGGYPTFTWPFASVTPNSGALATVVGYPFGVNFPVLNGRQWLQI
FNNVTYYLWNKSFAADSVAMQTDGNLVVYNKGQPVWSTGTSGNPGAYMLVTPVGFVLGKQ
YGGILANVPYPVSVDQSSRASGPNDPKPTPAAPPPPSLNLPINASWKCYYVKDWLACYAP
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaaaaaatacgcattggcgctctggttcatgctggtttcatcgatgtcggcaatggcg
ggggcgatcattccatcgggcgcaacgctggttgcggggcaatacgcgatatcgaacaac
ggcaacttcgcattcggcgtcgacgccgccagcggcaagctctatttccactacaggttc
ccgacgcaggcgtggggcgcgagcgcgatgtcgcaaatgtacggaacgcagcccgagggc
gcgctctacgtcggcaagggcgaccggctcgtgatgcagaccgacgggcgactcgtgttc
tattcgggcaacgacgtcgtctggagcaactggtattacggccccgcgccgatccccggc
tcgtatgcggtcgtcgaggatttcggcgtcgtcgcgatctatccgccgcagggcggctat
ccgacgttcacctggccgttcgcgtcggtcacgccgaacagcggcgcgctcgcgacggtg
gtcggctatccgttcggcgtgaacttcccggtgctcaacgggcgccaatggctgcagatc
ttcaacaacgtcacttactacctgtggaacaagagcttcgccgcggacagcgtcgcgatg
cagaccgacggcaatctcgtcgtctacaacaaggggcagccggtctggtcgacgggaacg
tcgggcaatccgggcgcctacatgctggtgacgcctgtcggcttcgtgctcggcaagcag
tacggcggcatcctcgcgaacgtgccctacccggtgtccgtcgatcagtcgagccgcgcg
agcggcccgaacgatccgaagccgacgccggccgcgccgccgccgccctcgctgaacctg
ccgatcaatgcgagctggaagtgctattacgtgaaggactggctcgcgtgctacgcgccg
ggttga

DBGET integrated database retrieval system