KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0959
Entry
GBP346_A0959      CDS       T00894                                 
Name
(GenBank) traf peptidase, serine peptidase, merops family s26c
Organism
bpr  Burkholderia pseudomallei MSHR346
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ACQ97016
UniProt: C4KSF1
Position
I:920942..921529
AA seq 195 aa
MTVTTASLSRSPAHSRLRARLVLACLSACGLVALAWASFVHPLPRLTYNPSDSVAVGWYR
VDPLDHRTSSPPRPLPVGSIVLVPLPAEAAALAAQRGYLPTRIPLLKRVGAVAPQEVCIA
DGRVRIDGVPSAAVLPTDRWGRPLPSWQQCRRLRPGELFLLSVTNPASFDSRYFGPISAA
AVIGIARPVWLESRP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacggtcacaacagcatcactttctcgctcgcctgcgcactcacgtttgcgcgctcgc
ctcgtgctggcgtgcctgtccgcctgcggcctcgttgcgctggcctgggcgtccttcgtg
catccactgccgcgcctgacctacaacccgtccgacagcgttgcggtcggctggtatcgt
gtcgatccgctcgaccatcgcaccagctcgccgccacgtccgttgcccgtaggcagcatc
gtgctggtgccgctgcccgccgaggctgccgcgctcgctgcgcagcgcggctacctgccg
acgcgcatcccgttgctcaagcgcgtaggcgcggtggcgccgcaagaggtgtgcatcgct
gacggcagagtccgcatcgacggcgtgccttcggccgctgtgctgcctaccgatcgctgg
ggacggccgctgccatcctggcagcagtgccggcgccttcggcctggcgaactgttcctg
ctcagcgtcaccaatccggcgtcgttcgacagccgctacttcgggccgatcagcgccgcc
gccgtgatcggcattgcgcgcccggtctggctggagtcacgcccatga

DBGET integrated database retrieval system