KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0968
Entry
GBP346_A0968      CDS       T00894                                 
Name
(GenBank) conjugal transfer protein TraG
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GBP346_A0968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0968
Enzymes [BR:bpr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     GBP346_A0968
Secretion system [BR:bpr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   GBP346_A0968
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Other DBs
NCBI-ProteinID: ACQ96147
UniProt: C4KSG0
Position
I:933772..935775
AA seq 667 aa
MRAQGVLFGQVATVSGIVIAGVWGATQWTAAALGHQARLGLPWLNVFDTPVYYPWQLFEW
WFFYDAYAPRVFDMGGAIAGGSGLAAAGAAMAMSVWRSRQSKRVTTYGSARWAEAADIRK
AGLDQPAGVFLGLHRGQYLRHDGPEHVLTFAPTRSGKGVGLVIPTLLSWPASAVIHDIKG
ENWQITAGWRARFSHCLLFNPADPKSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
RRNHWEKTSHALLVGAILHVLYAGEDKTLRGVTNFLSDPVCPFELTLHRMMTTRHLGDAP
HPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIASEYPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGTDGIARKHRLLLMLDEFPALGRLDFF
ESALAFMAGYGLRAFLIAQSLNQIDRAYGQNHSILDHCHVRVTFATNDERTAKRISETLG
TSTELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDDALVMVSSVAPIKA
KKLRYYADANFKQRVLPPPALSAGRYADVPPLRPDDWRGLAIPAVPAVRAASTDWPDSDT
ATTADDGGPRRQPELSGVTSGGPEHAPLANDLALLDDDDLSLPSQLDPAMQRNALLASLD
QPDGIER
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgcgagctcaaggtgtgctgtttggtcaagtcgccacggtgtctggcatcgtgatcgct
ggcgtgtggggcgctacgcaatggacggccgccgcactgggccatcaggcgcgactcggc
ttgccctggctcaatgtcttcgacacgccggtctattacccctggcagctcttcgagtgg
tggttcttctatgacgcctacgcgccacgcgtttttgacatggggggcgcgatcgcggga
ggcagcggcctagcggccgcaggggccgccatggcgatgtcggtctggcgatcgcgtcaa
tcgaagcgggtcacaacctatgggtcggcgcgctgggccgaagctgccgacattcgcaaa
gccggcctcgaccagccggccggtgtattcctcggcctgcatcgcggccagtatcttcgc
catgacggcccggaacacgttctgacgtttgcaccaacgcgctctggcaagggcgtcggc
ctggtcatacccacattgttgagttggccggcgtcggctgttatccacgacatcaagggg
gagaactggcagatcactgctggctggcgcgcccgcttttcgcactgccttctgttcaac
cccgccgatccaaagtcggctgcatacaatccgttgctggaagtccggcgcggggcacat
gaagtgcgcgatgtgcagaacatcgccgacattctggtcgatccagaaggtgcactggag
aggcgcaaccattgggaaaaaacctcgcacgcgctattggtcggcgccatcctgcacgtg
ctctatgcgggcgaagacaagacgctgcgcggcgttaccaacttcctgtccgatcccgtg
tgcccgttcgagctgacgctgcaccggatgatgaccacacggcatctcggtgatgcgccg
catccggtagtggcctccgctgcgcgcgaggtgcttaacaaaagcgacaacgagcgctcc
ggcgtattgtcgaccgccatgtcgtttctcggcctgtaccgcgatcccacggtggcggag
gtcacctcgcgctgtgattggcgcatcgccgacctgatcgcatccgaatacccggtgtct
ttgtatctggtggtgccgccctcggacatcagccgcaccaagccgttgatccggctaatc
ctcaatcagatcgggcggcgactcacggagtcgcttgacggcacggacggcatcgcgcgc
aagcaccggctgctgttgatgctcgacgagtttcctgcgctgggccgcttggatttcttc
gagtccgcgctggccttcatggcgggttatggcctgcgggccttcctgattgcgcagtcg
ctcaatcagatcgatcgcgcctacggccagaaccattcgatcctcgaccactgccatgtg
cgcgtgacgttcgccaccaacgacgaacgcacggccaaacgcatttccgagacgctgggc
acgtcgaccgaactgcgcgcgcagcgcaactatgcgggccatcggcttgcgccgtggctg
ggccacctgatggtctcgcggcaggagacggcgcgcccactgctcacgcctggcgaagtg
atgcagctcccgccggatgatgccctcgtgatggtgtccagcgtggcaccaatcaaggca
aaaaaactgcgctactacgccgatgccaatttcaagcagcgcgtattgccgccgcctgcg
ctctcggccggacgctacgccgacgtaccacctctgcgcccagacgactggcgtggcctt
gctatccccgccgtaccggcagttcgggccgcatccactgactggccggacagcgacact
gcgaccaccgccgacgacggcggaccgcgccgccagccggagttgtccggagtcaccagc
ggcggcccggagcacgcaccattggccaacgacttggcgctgctcgatgacgacgacctg
tcgcttcccagtcagctcgatccggccatgcagcgcaacgccctgctggcatcgctcgac
caacccgatgggatcgagcgatga

DBGET integrated database retrieval system