KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0970
Entry
GBP346_A0970      CDS       T00894                                 
Symbol
trbB
Name
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0970 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0970 (trbB)
Enzymes [BR:bpr01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     GBP346_A0970 (trbB)
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0970 (trbB)
SSDB
Motif
Pfam: T2SSE TrwB_AAD_bind FtsK_SpoIIIE AAA_7 AAA_16 Zeta_toxin AAA_28 AAA_30 ATPase IstB_IS21 ABC_tran MMR_HSR1 AAA_25 DEAD CbiA Sigma54_activat AAA_19 ResIII MobB TsaE AAA_29 Phosphatase AAA_10 GTP_EFTU CLP1_P
Other DBs
NCBI-ProteinID: ACQ95207
UniProt: C4KSG2
Position
I:936233..937261
AA seq 342 aa
MTARPDSFVTTSLDRRIRMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWVDRLSSGRAPL
GATLSEEDGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKR
AVGVIALERYVADGMMTVQQAAFLRRAVRERQNVLIAGGTSTGKTTLANALLAEIAATGD
RVLVLEDTIELQCVARDHVPLRTRAGVVSMAELVRATMRLRPDRVIVGEVRGGEALDLIK
VWGTGHPGGIATIHAGSELGALLRLEQLILEVAVNPPRALIAEAVNVVIYLAGRGKKRRI
ERIARVVGCDHASYHLTDALETPLPGLQPLDAPSSNDVGARP
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgactgcacgacccgattcgtttgtcaccacgtccctcgaccggcgcatccgcatgctg
cgcacggcaatggggccgctgatcgccgccgcgctggaagacccggacgtggtggaaatc
atgctcaaccccgatcggacgctgtgggtcgatcgcctgtcttccggtcgcgcgccgctg
ggcgcgacactttccgaggaagacggcgaacgcatcatccgcctggtagccgcgcatgtc
ggcgcggaagtccatcgcggccagccgctactaacggccgaattgcccgagaccggcgag
cgcttcgagggcatcctgccgccggctgctccgggaccggcctttgcgctgcgcaagcgt
gccgtgggtgtcattgcgctggagcgctacgtcgccgacgggatgatgacggtgcagcag
gctgcgttcctgcgtcgtgccgtgcgcgagcggcagaacgtcctgatcgcgggcggcacc
agcacgggcaagaccacgttggccaatgcgctgctggcggagatcgccgccacgggcgat
cgcgtgttggtgcttgaggacacgattgagctgcaatgcgtcgcgcgcgaccacgtgcca
ctgcgcacgcgcgcaggcgttgtgtccatggccgaactggtgcgcgccaccatgcgcctg
cggcctgatcgggtgatcgtcggcgaggttcgcggtggcgaggcgctggatctcatcaag
gtctggggcacaggccatcccggcggcatcgccaccattcacgccggctcggaactcggg
gcactgctgcgcctggagcaactgattctcgaagtcgcggtcaacccaccgcgcgcgctg
atcgccgaggcggtcaatgttgtgatctatctcgccggtcgtggcaagaagcgccgcatc
gagcgcatcgctcgcgttgtcggctgcgaccacgcgagctatcacctgaccgatgccctg
gaaacgccgcttcccgggttgcagccgcttgacgcgccatcctccaacgatgttggagca
cggccatga

DBGET integrated database retrieval system