KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0971Help
Entry
GBP346_A0971      CDS       T00894                                 

Definition
(GenBank) conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0971
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0971
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ACQ98453
UniProt: C4KSG3
Position
I:937258..937632
Genome map
AA seq 124 aa AA seqDB search
MTQGHPLVLRGCVNPLARLWRFAGLGQGGLWLGGVLLSMAGPGRAAGSSMPWEGPLQSIL
ESIQGPVARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSG
GAVV
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagggtcacccccttgttttgcgtggttgcgttaatccgcttgctcgcctgtgg
cgtttcgccgggctggggcagggtgggttgtggctgggcggcgtgctgttgagcatggcc
ggtcccgggagggcagcaggttcctcgatgccctgggaaggtccgctgcaatctattctc
gaatccatccaggggccggtggcacgcattatcgccgtcatcatcatcattgcgaccgga
ctcgcgcttgcgttcggcgataccagtgggggctttcgcaagctgatccagatcgttttc
ggcctgtcgatcgccttcgcggcatcctcgtttttcctgtctttttttagcttttccggc
ggagccgtcgtatga

DBGET integrated database retrieval system