KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0974Help
Entry
GBP346_A0974      CDS       T00894                                 

Gene name
trbJ
Definition
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0974 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0974 (trbJ)
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0974 (trbJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKA2 Med9 Cauli_AT LZ3wCH DUF948
Motif
Other DBs
NCBI-ProteinID: ACQ97223
UniProt: C4KSG6
Position
I:940368..941132
Genome map
AA seq 254 aa AA seqDB search
MTFHILLKARLTALVAGASLVLTSAQPAHALLGVGDIVFDPTNLVQNTLTAARTLEQINN
QIKQLQNEAQSLTNQARNLAGLPFNVVNRLRTNLDTTRQLIARAQGVAYDLQQMDQQFVQ
LYPEQYAATVSGNQMFKDAHQRWRNTLQGLQTAMRMQAQVSQNVNRDEDVLADLVGQSQS
ATGALQAMQATNQLLALQAKQSIQTQQLQLTQDRAASLELARQASAVERGREVTRRFLGN
GTAYTPQPVNFYRN
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacgttccacattcttttaaaggctcgcctgactgcgctggtcgccggcgcgtcgctg
gttttgacttccgcgcagcccgcccatgcgcttttgggtgttggcgacatcgtgttcgat
ccgaccaacctcgtgcagaacactctgacggccgcccggacgctggaacagatcaataac
cagatcaagcaactccagaacgaggcgcagtcgttgacgaaccaggcccgcaaccttgca
ggcctgccgttcaacgtggtcaaccggctgcgcaccaacctggacacgacgcggcaattg
atcgcgcgcgcgcagggggtggcttacgacctccagcagatggaccaacagttcgtgcaa
ctgtaccccgagcagtacgccgcaaccgtgagcggcaaccagatgttcaaggacgcgcat
cagcgctggcggaacacactccaaggcctgcagactgcgatgcgcatgcaggcacaggtg
tcgcagaacgtgaaccgggatgaggacgtgttggccgatctggtcggccagagccagtcg
gccaccggcgccctgcaggccatgcaggcaaccaaccagcttctggcgctgcaagccaag
cagtccatccaaacgcagcagcttcagctcacgcaggatcgggcggcttccctggaactc
gcaaggcaagcatctgccgttgaacgcggacgcgaagtcacgcgccgtttccttggcaat
ggcaccgcgtacacgccgcagcccgtgaacttctatcgcaactga

DBGET integrated database retrieval system