KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0976
Entry
GBP346_A0976      CDS       T00894                                 
Name
(GenBank) conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0976
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0976
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0976
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: ACQ98530
UniProt: C4KSG8
Position
I:942342..943046
AA seq 234 aa
MRFKRPQVRYADTPQPATPYQSAAQVWDARIGSARVQAKNWRLMAFGCLVLALMMAGGLV
WRSAQSIVTPYVVEVDQSGQVRTVGEAAIPYRPSDAQIAFHLAHFITLVRSLSIDPVVVR
QSWLDAYDYTTDRGAGVLNDYARAHDPFILVGKESVTVQITSVVRASESSFNVRWTEQRF
VNGAPASTERWNAMLTTVLQTPRTEQRLRKNPLGIYINGLSWSRELDTPEGAKP
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcgattcaagcgaccacaggtacgctacgccgatacgccgcagcctgccacgccgtac
caatccgccgctcaggtttgggacgcacgcatcggctcggcgcgcgttcaggcgaagaac
tggcggctgatggccttcggctgcctggtgctcgcgctcatgatggccggtggactggtc
tggcgctcagcgcagtcgatcgtcacgccttacgtggtggaggtggatcagagcggtcag
gtgcgtacggtcggcgaggcagccataccgtaccggcccagtgacgcgcaaatcgccttc
cacttggcgcacttcatcacgctggtccgttcgctctccatcgaccccgtcgtcgtccgg
cagagttggctcgatgcctacgactacaccaccgatcgtggcgcaggcgtgctcaacgac
tacgctcgcgcccacgatccttttatcctcgtcggcaaggagtcggtgaccgtgcagatc
accagcgtcgtgcgggccagcgaatcgtcgttcaacgtgcgctggaccgaacagcgtttc
gtcaacggtgcacccgcgagcaccgaacgctggaacgccatgctgaccaccgttctgcaa
acgccgcgcaccgagcagcggctgcgcaagaacccgctggggatctatatcaacggcctg
tcgtggagccgcgagctggatacgcctgaaggagcgaagccatga

DBGET integrated database retrieval system