KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0977
Entry
GBP346_A0977      CDS       T00894                                 
Symbol
trbG
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0977 (trbG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0977 (trbG)
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0977 (trbG)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ACQ95986
UniProt: C4KSG9
Position
I:943043..944047
AA seq 334 aa
MNALVHQSALPVILLGSTVLFAGCATQGKPPPTIALDEPVQAQPLPEPPKPIEVVTVPQV
LPMPAQMKPLSEGAEVKTAPEPTDEKLRVSRANAEARVAPTREAYVNAIQVWPFTDGALY
QVYAAPGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGTGDALRVNVMVKPIRSNLKTN
LVITTSRRTYLIELTSTEKAWMASVSWDYPKDRMLALQRQAQSAQATAPVETGLPLEKIR
FRYAVSGSNAPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGAQGEGQLVNYRFRTPY
YIVDRLFGAAELRLGGDKGDVVRIERTDGVTRGN
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaatgcccttgtccatcaatccgcgttgccggtgatcctactaggttcgaccgtgctg
tttgcaggctgcgccacccaaggcaagccaccaccgaccatcgcactcgatgagccggtg
caggctcagccgctacccgagccgccgaagccgatcgaagtcgtgaccgtgcctcaggtc
ctgcccatgcctgcgcagatgaagccgctgtcggagggcgcggaagtcaagaccgcaccg
gagccgactgacgagaaactgcgggtatcgcgggctaatgccgaggcgcgtgttgcaccc
actcgggaggcttatgtcaacgcgatccaggtctggcccttcaccgatggtgcgctctac
caggtctatgcggcaccggggagggtgaccgtgattgcgctgcaacctggcgaggaactt
gtgaccgttgccgccggtgacacagtgcgttggatcgtcggcgacacatccagcggcacg
ggggacgcgctgcgcgtcaacgtgatggtcaagccgatccgctcaaacctgaagaccaat
ctggtcatcacgaccagccggcgcacctacctgatcgagttgacctcgaccgagaaggcg
tggatggcctcggtgtcgtgggattacccgaaggatcgtatgctggccttgcagcgtcag
gcgcagtctgcacaagcgacggcgccggtcgaaaccggcctgccgctggagaagattcgc
tttcgctacgcggtcagcggcagcaatgcgccgtggaagccgctgcgcgcctttgacgac
ggcgagaaggtctatatccagttcccggcgggcattgctcagggggagttgccaccccta
ttcgtgattggcgcgcagggcgaggggcaactggtgaactaccgattccgcaccccgtat
tacatcgtcgatcgattgttcggcgcggccgagctgcgcctgggtggcgataagggcgat
gtggtgcgcatagagcgcacggatggcgtaacgcgggggaactga

DBGET integrated database retrieval system