KEGG   Burkholderia pseudomallei MSHR346: GBP346_A0978
Entry
GBP346_A0978      CDS       T00894                                 
Name
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GBP346_A0978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A0978
Secretion system [BR:bpr02044]
 Type IV secretion system
  Trb secretion system protein
   GBP346_A0978
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ACQ97123
UniProt: C4KSH0
Position
I:944050..945330
AA seq 426 aa
MGQDDTPDVPGSDTVPKVAPEAVALRAQPRAVTRLNRRTLALLAGSFGIAVLGATLWSLQ
PSKQRAANDATELYNVDRVSRSEGLDRLPADYAKLPANVPELGPPLPGDLGPAIAKSQQP
VTSTYAPPGQDPGAAERDALRKEAETAAGSSVFFRSSNQRGNAAPGQTTAAAPASGPLGF
DPQAAGPASTAAQPADPTAVQNRQDQKEAFQKAGSTETRNAGNLQVPTSPYQVMAGTVIA
GALVTGIKSDLPGDVIAAMTEPVYDTATGRHLLIPQGSRILGRYNSQVSYGQSRVQVVWN
RIILPDTSSLTLDKLAGTDPAGYSGLEDGVDWHWDRVFAGAALTTLLGVGAELAAPQNRS
GDRIIIAGRDGLQDSVNQVGQEMTRRNLNIQPTLTERPGLPVRILVNRDLVLRPYQPLFF
NKGTSQ
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgggccaggacgacaccccggacgtacccggttctgacaccgtgccgaaagtcgcaccg
gaggccgtggctttgcgggcgcagccgcgcgcggtgacacggctgaaccggcgcacgtta
gcgctgctggccggcagctttggcatcgcggtgttgggcgcaacattgtggtctctacag
ccatcgaagcagcgtgccgcgaacgatgcgaccgagctctacaatgttgatcgcgtctct
cgctccgaagggctcgaccggcttccggccgactacgccaagctgccggcgaacgtgccg
gagctggggccgccgctgcccggcgacctggggcccgccatcgccaaatcgcagcaaccg
gtgacatctacctatgcgccaccgggtcaagatccgggggcggccgaacgcgatgcgttg
cgcaaggaggcggaaactgcagcgggttcgtcggtgttcttccgttcgagcaatcaacgt
ggtaacgccgcgcccgggcagaccacggcggccgctccggcatctggccccctgggcttc
gatccacaggcggcaggaccagcctccacggcggcgcagcccgccgacccgactgccgtg
caaaaccggcaagaccagaaagaggcgttccagaaagccggatctacggaaacccgcaat
gccggtaatctgcaggtgcccacctcgccgtatcaagtcatggcgggaacggtgatcgca
ggtgcgctggtgacgggcattaagtcggatttgccgggcgacgtgattgccgcgatgacg
gagccagtctacgacacggcgaccggacgccatctgctgatcccgcaaggctcacgcatt
cttggacgctacaacagccaggtcagctatggacagagtcgggtgcaggtcgtgtggaat
cgcatcatcctgcccgacacgtcctcgctgacgctggacaagctggccggcaccgatccg
gctggctactccgggttggaggatggtgtcgattggcattgggaccgcgtctttgccggc
gccgcattgacgacgctgctgggtgtcggcgccgagttggctgcaccgcagaaccgtagc
ggagaccggattatcatcgcagggcgcgacggcttgcaggacagcgtgaaccaagtcggg
caggagatgactcggcgcaatctcaacattcagcccaccttgactgagcggccgggcctg
ccggtacgcatccttgtcaatcgcgatctggtactgcggccctaccagccgctcttcttc
aataagggaacatcgcaatga

DBGET integrated database retrieval system