KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1038Help
Entry
GBP346_A1038      CDS       T00894                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00860  Porphyrin and chlorophyll metabolism
bpr01100  Metabolic pathways
Module
bpr_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GBP346_A1038 (cobQ)
Enzymes [BR:bpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     GBP346_A1038 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: ACQ97143
UniProt: C4KSM8
Position
I:998513..1000144
Genome map
AA seq 543 aa AA seqDB search
MRPSPFAARRASRHSFTMIANANANANANANANANANANANANANANANAARPRGTLMIQ
GTTSDAGKSTLVAGLCRLARRTGARVAPFKPQNMALNSAVTANGGEIGRAQALQALAAGI
EAHTDLNPVLLKPTGDRGAQVIIHGKARANLDARAYHDYKPTAMRAVLESYGRLRGAYDA
VIVEGAGSPAEINLREGDIANMGFAEAVDCPVVLVADIDRGGVFAHLVGTLACLSDSERA
RVRGFVINRFRGDPALLEPGLRWLEARTGKPVLGVLPYLHGLTLDAEDMLPASARTSAAR
RDAGVLRIVVPALPRISNHTDFDALRAHPRVDFTYWRRGPVPDADLLILPGSKNVLADLA
WLRDAGWDALIKRHLRYGGKVIGICGGMQMLGRTLADPHGVEGAAGATSAGLGLLDYATT
LTPEKTLVNAAGRLAFGGDARVAGYEIHMGRTEGPALASPALVLAGRGGERPDGALSADG
QILATYLHGLFDTPHACAALLEWAGLDGAEALDYPALREASLERLADTFAEHLDLDRVFA
AFA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcggccttcgccatttgccgcgcgccgcgcgtcgcgccattcgttcacgatgattgcc
aacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgccaacgcc
aacgccaacgccaacgccaacgccaacgccgcccgtccgcgcggcacgctgatgatccag
ggcacgacgtccgacgcgggcaagagcacgctcgtcgcgggcctgtgccggctcgcgcgc
cgcacgggcgcgcgcgtcgcgccgttcaagccgcagaacatggcgctcaacagcgcggtg
acggcgaacggcggcgagatcggccgcgcgcaggcgctgcaggcgctcgcggcgggcatc
gaagcgcataccgatctgaacccggtgctgctgaagccgacgggcgatcgcggcgcgcag
gtgatcatccacggcaaggcgcgcgcgaacctggacgcgcgcgcctatcacgactacaag
ccgaccgcgatgcgggcggtgctcgaatcgtacggccggctgcgcggcgcgtacgacgcg
gtgatcgtcgaaggggcgggcagccctgccgagatcaacctgcgcgaaggcgatatcgcg
aacatgggtttcgccgaagcggtcgattgcccggtcgtgctcgtcgcggacatcgatcgc
ggcggcgtgttcgcgcatctcgtcggcacgctcgcgtgcctgtcggacagcgagcgcgcg
cgcgtgcgcggcttcgtgatcaaccgctttcgcggcgatccggcactgctcgagccgggg
ctgcgctggctcgaggcgcggaccggcaagcccgtgctcggcgtgctgccctatttgcac
gggctcacgctcgacgccgaggacatgctgcccgcgagcgcgcgcacgtcggcggcgcgg
cgcgacgcgggcgtgctgcgcatcgtcgtgcccgcgttgccgcgcatcagcaaccatacc
gatttcgacgcgttgcgcgcgcatccgcgcgtcgatttcacgtactggaggcgcgggccc
gtgcccgacgccgatctgctgatcctgcccggctcgaagaacgtgctcgccgatctcgcg
tggctgcgcgacgcgggctgggacgcgctgatcaagcgccatctgcgctacggcggcaag
gtgatcggcatctgcggcggcatgcagatgctcggccgcacgctggccgatccgcatggc
gtcgagggcgcggccggcgcgacgagcgcgggcctcggcctgctcgactacgcgacgacg
ctgaccccggagaagacgctcgtcaacgcggcggggcggctcgcgttcggcggcgatgcg
cgcgtcgcgggctacgagatccatatgggccgaaccgaagggccggcgctcgcgtcgccc
gcgctcgtgctcgcggggcgcggcggcgagcggcccgacggcgcgctgtcggcggacggg
cagattctcgcgacctacctgcacgggcttttcgacacgccgcacgcatgcgcggcgctg
ctcgaatgggcggggctcgacggcgcggaggcgctcgactatccggcgctgcgcgaggcg
tcgctcgagcggctcgccgacacgttcgccgagcatctcgatctcgatcgcgtgttcgcg
gcgttcgcgtga

DBGET integrated database retrieval system