KEGG   Burkholderia pseudomallei MSHR346: GBP346_A1625
Entry
GBP346_A1625      CDS       T00894                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpr  Burkholderia pseudomallei MSHR346
SSDB
Motif
Pfam: DUF2235
Other DBs
NCBI-ProteinID: ACQ97101
UniProt: C4KVU1
Position
I:1562361..1564769
AA seq 802 aa
MSYRFASADRFDVNVVTKDEQDAILRRLHEDDGMACCKTLHIGIFFDGTRNNADRDRGAR
TESNVARLYAAFPIDKYHQAIYVAGVGTPFVEQIGDFGVGLQAAAGAAAGWAGEGRINWA
LLRIHDILHAYVHGQTLTAVLGKRYEELVKSMSLDMNFKGIDLGGTPPKPGSFGDIKLRA
NSGVGALKLIAAEQNGVELTWDLDTNWAQLKNELDSSKWNAAVQEWDAKRRKVLLDRRAQ
LKARIGDLLVKGKPKLQRIRLYVFGFSRGAAEARTFSNWLADALDPDFSLCGVPVSYDFL
GIFDTVASVGIAQSAAATLFDGHGGWGRKELMAVPHYVRRCVHMVAAHEPRGSFPLDLID
CSMDGREEIVYPGVHSDVGGGYGPGEQGRGRDDADKLSQVPLLDMYREARKAGVPLDING
PGIGADVIAAFKVSAGLKQAFAAYVKKSENYYYEKDHGTPGLMRCHYGLYLRWRKMRLKD
MHAQPSFKAAQARYPQDAADLDSANAELKEEWNDLLEVEKAGGPTITRYVEKFVTKWASE
NPKTAAVVSTSLLPAAVAAEIFVPGVSAATVLFGDKVVKLVQAQLKEKWEQWLQVRSDWN
MGPPEPAISALYDNYMHDSRAWFKPLGDDDDVWNHRQIQELKTKQASFERAHAAWKKRVE
MGMPSPLQVTQAMGVGSTGWGPVGGLPPEPEPRSPLTAQQADLLKRYDAAMQSAKQARAA
KDPNAPTDSAVLTDPKVTGGLALQTSGREFYFLWGFLRWRTVFVNGVRWDQPRVPTVQEE
MEGMRMQMQRQVDMKGIGVLFQ
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgagttatcgtttcgcatccgccgaccgatttgatgttaatgtcgttacgaaagacgag
caggacgctattttgcggaggctgcatgaagatgacggcatggcttgttgtaagacattg
catatcggaatcttctttgatggtacgcgtaacaacgctgatcgggataggggggcgcga
acggaaagcaatgtggcacggctttatgccgcttttccaatagataaatatcaccaagcg
atttacgttgctggagttggcacgccttttgtcgagcagattggtgatttcggtgttggc
ttacaggcggccgcaggagctgcggcaggttgggcgggagaggggcgaattaactgggct
ttgcttcggattcacgatattttgcatgcgtatgttcacggtcagacgttaacggcagtg
ttaggaaagcgctacgaggaactcgtaaaatcgatgagcctcgatatgaattttaagggc
atcgaccttggcggaacgccgcctaaaccgggaagcttcggcgatatcaaattgcgtgcc
aattctggtgtgggggcgctcaagctgattgctgccgaacagaatggtgtcgagctgact
tgggatttagatacgaattgggcgcagctcaaaaacgagttggattcgtcgaagtggaat
gcagccgtgcaagaatgggacgccaagcgccgcaaggtattgctcgatcgtcgtgctcag
ctaaaagcgcgcatcggtgatctgctggtcaaggggaagccgaagctgcaacgcattcgg
ctatacgtattcggtttttcgcgcggcgcagcggaggctcgcactttctcgaactggctt
gctgacgcgcttgaccccgatttcagtttgtgtggagtgccggtttcatacgattttctc
ggcatctttgatacggtcgcatcggtcggcatcgctcagagcgccgccgcaacattattc
gacggacatggaggatgggggcgcaaggaactgatggccgtgccgcattatgtgcgccgt
tgcgtgcacatggtggcggcacatgaacctcgtggatcatttccgctcgaccttatcgat
tgttcgatggacggtcgtgaggagattgtctacccgggtgttcactcggacgtcggcggc
ggctatgggccgggcgaacaggggcgcggtcgggacgacgccgacaaactttcgcaagtc
ccgctgcttgatatgtaccgggaggcgcgtaaggcaggtgtgcccttggatatcaatggg
ccgggtatcggcgcggacgtcatcgctgcattcaaggtttcagcagggctaaaacaagcc
ttcgcagcctacgtaaaaaagagcgagaactattattacgagaaagatcacggcacgccg
ggcctaatgcgttgccattacggcttgtatctccggtggcgcaagatgcggctcaaggac
atgcatgcacagcccagcttcaaggctgcgcaggcgcgctatccgcaagatgcagcggat
ctggacagtgcgaacgcggaattgaaggaggagtggaacgatttgctggaggtcgagaaa
gctggcggcccgacaatcacccgatacgtggagaagtttgttacgaaatgggccagtgag
aatccgaaaacggccgccgtcgtttccacgtctctacttccggccgcggtcgctgctgag
atttttgttccgggggttagcgctgcgacggttctattcggcgacaaagtggtgaaactg
gtgcaagcccaactcaaggagaagtgggagcagtggctgcaagttcgcagcgactggaac
atggggccgcctgaacctgcgatcagcgcactctacgacaactacatgcacgactcccgc
gcatggttcaagccgctcggcgacgatgacgacgtgtggaaccataggcagattcaggaa
ctcaagaccaagcaagccagctttgaacgcgcccatgctgcctggaaaaagcgtgtcgaa
atgggcatgccaagcccgttgcaggttacacaggcaatgggcgtaggttccacaggatgg
gggcccgtcggcgggcttccgcccgaacccgaaccccgctccccgctcaccgcccagcaa
gccgatctgctcaagcgctacgacgccgcgatgcagtccgccaagcaggcacgcgccgca
aaggacccgaacgcgccgacggacagcgccgtgctgaccgatccgaaggtgacgggcggc
ctcgcgctgcaaaccagcggccgcgagttctatttcctgtggggcttcctgcgctggcgg
accgtgttcgtgaacggcgtgcgctgggaccagccgcgcgtgccgacggtgcaggaggaa
atggagggcatgcgcatgcagatgcagcgccaggtcgacatgaagggcatcggcgtactg
ttccaatga

DBGET integrated database retrieval system