KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2273Help
Entry
GBP346_A2273      CDS       T00894                                 

Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr00071  Fatty acid degradation
bpr00072  Synthesis and degradation of ketone bodies
bpr00280  Valine, leucine and isoleucine degradation
bpr00310  Lysine degradation
bpr00362  Benzoate degradation
bpr00380  Tryptophan metabolism
bpr00620  Pyruvate metabolism
bpr00630  Glyoxylate and dicarboxylate metabolism
bpr00640  Propanoate metabolism
bpr00650  Butanoate metabolism
bpr00900  Terpenoid backbone biosynthesis
bpr01100  Metabolic pathways
bpr01110  Biosynthesis of secondary metabolites
bpr01120  Microbial metabolism in diverse environments
bpr01130  Biosynthesis of antibiotics
bpr01200  Carbon metabolism
bpr01212  Fatty acid metabolism
bpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GBP346_A2273
   00630 Glyoxylate and dicarboxylate metabolism
    GBP346_A2273
   00640 Propanoate metabolism
    GBP346_A2273
   00650 Butanoate metabolism
    GBP346_A2273
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GBP346_A2273
   00072 Synthesis and degradation of ketone bodies
    GBP346_A2273
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GBP346_A2273
   00310 Lysine degradation
    GBP346_A2273
   00380 Tryptophan metabolism
    GBP346_A2273
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GBP346_A2273
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GBP346_A2273
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GBP346_A2273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpr04147]
    GBP346_A2273
Enzymes [BR:bpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GBP346_A2273
Exosome [BR:bpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GBP346_A2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACQ98770
UniProt: C4KMN0
Position
I:complement(2238674..2239855)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGASVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAVVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGITAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLAGLKPAFAKEG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMLKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagttcggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgagcgtgattcgcgcggtgctcgaacgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctgggccaggtgctgacggcgggc
tcgggccagaatccggcgcgccaggcgctgatcgcggcggggctgccgaacgcggtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgcttgccgcgaac
gcggtcgtcgcgggcgatgcggagatcgtcgtcgcgggcggccaggagaacatgagcgcc
gcgcctcacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagctcgtc
gacagcatgatcgtggatggcctctgggacgtctacaacaagtaccacatgggcatcacc
gcggagaacgtcgcgaaggagtacggcatcacgcgcgaggcgcaggaccagttcgccgcg
ctctcgcagaacaaggcggaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccgatcgagatcccgcagagaaagggcgagccgctgcgtttcgcgaccgacgagttcgtg
cgtcacggcgtgacggccgagtcgctcgcgggcctgaagcccgcgttcgcgaaggaaggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgaggcgctcggcctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcgtcgcgccgctgt
ctcgagcgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggttcacaagcagatgggctgggatacgtcgaaggtcaacgtg
aatggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgctcaagcgcgatgcgaaacgcggcctcgcatcgctttgcatc
ggcggcgggatgggcgtcgcgctcgcgctcgagcgtccgtaa

DBGET integrated database retrieval system