KEGG   Burkholderia pseudomallei MSHR346: GBP346_A2748Help
Entry
GBP346_A2748      CDS       T00894                                 

Definition
(GenBank) PHP C-domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GBP346_A2748
Enzymes [BR:bpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     GBP346_A2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP NIR_SIR_ferr DUF442
Motif
Other DBs
NCBI-ProteinID: ACQ97160
UniProt: C4KQI9
Position
I:complement(2677383..2678213)
Genome map
AA seq 276 aa AA seqDB search
MNADLHCHSNVSDGQLAPADVARRAHAGGVTLWALTDHDEVGGQRAAREAAEALGMRYLH
GVEISVTWASRTVHIVGLNIDPRNPALVDGLHRTRNGRAARAVAIGDALAALGIEAAYEG
ALAYVSNPDLISRTHFARFLVDKGYAASMSDVFDRYLGDGKPGYVAHRWAKLSDAVAWIR
QAGGEAVVAHPGRYAYTSVEFDAFFGEFIELGGVAIEVVTGSHTPDQYREYADVARRFGF
EASRGSDFHAPGEGRTEFGSLPPLPSDLKPVWERWL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgatctccactgccattcgaacgtttccgacggtcagctcgcgcccgccgac
gtcgcgcgccgcgcgcacgcgggcggcgtcacgctgtgggcgctgaccgatcacgacgag
gtcggcggccagcgcgccgcgcgcgaagccgccgaggcgctcggcatgcgctatctgcac
ggcgtcgagatttccgtgacctgggcgtcgcgcaccgtgcacatcgtcggcctgaacatc
gatccgcggaaccccgcgctcgtcgacgggcttcaccgcacccgcaacggccgcgcggcg
cgcgcggtcgcgatcggcgacgcgctcgccgcgctcggcatcgaagccgcctacgagggc
gcgctcgcctatgtgtcgaatcccgatctgatctcgcgcacgcacttcgcgcgctttctc
gtcgacaagggctacgcggcgtcgatgtccgacgtgttcgaccgctatctcggcgacggc
aagccgggctacgtcgcgcaccgctgggcgaagctgtcggacgccgtcgcatggattcgg
caggcgggcggcgaagcggtcgtcgcgcatccgggccgctatgcgtatacgagcgtcgag
ttcgacgcgttcttcggcgagttcatcgagctgggcggcgtcgcgatcgaggtggtgacg
ggcagccatacgcccgaccagtaccgcgaatacgcggacgtcgcgcggcgcttcggcttc
gaggcatcgcgcggctccgatttccacgcgccgggagaagggcgtaccgaattcggcagc
ctgccgccgctgccgtccgatctcaaacccgtctgggagcgctggctgtag

DBGET integrated database retrieval system