KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3726Help
Entry
GBP346_A3726      CDS       T00894                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GBP346_A3726 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ACQ96721
UniProt: C4KVY7
Position
I:complement(3599726..3600310)
Genome map
AA seq 194 aa AA seqDB search
MLGAMRNCVMRGGRVGCVARRKNVILPPRHAPAGCGPGPHQAECRTKAARRPRGAGASAA
AAAGDLDGTTMSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWI
ITDSESQVQEVKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEA
PVDEFALHMPRTLH
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgctgggggcgatgcggaattgcgtcatgagaggagggcgcgtgggatgcgttgcaaga
cggaaaaacgtcattctaccgccgcggcacgcgccggccggttgcgggccggggcctcat
caagcagaatgccgaaccaaagcggcgcgtcggccgcgcggggcgggcgcctcggcggcg
gctgcggcgggcgacctcgacgggaccaccatgagccagtatcgattcagcgtgtcggtg
aagaccagctatttgccggaacaatccgaccccgaacaccgtcaatacgcattcgcgtac
acgctgacgatccgcaatacggggcaggtggccgcgcagttgatcgcccggcactggatc
atcacggacagcgagagccaggttcaggaggtgaaggggctcggcgtcgtcggccatcag
ccgttgctgcagccgggcgagcagttcgagtacacgagctgggcggtgatcgcgacgccg
gtgggcacgatgcgcggcgcgtatttttgcgtcgcggaggacggcgagcgcttcgaggcg
cccgtcgacgaattcgcgctgcacatgccgcgcacgctgcactga

DBGET integrated database retrieval system