KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3806
Entry
GBP346_A3806      CDS       T00894                                 

Gene name
vasA_3
Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
bpr  Burkholderia pseudomallei MSHR346
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A3806 (vasA_3)
Secretion system [BR:bpr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GBP346_A3806 (vasA_3)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACQ97985
UniProt: C4KW66
Position
I:complement(3670162..3672000)
AA seq 612 aa
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARIN
KKLDDEYPEFTEALVEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAI
RGVQCRFRTAYDVTLAPIRLADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAA
LKLGKLRAHLHGEQSFVAALADCLFAHALACYVEPDRGGRWIALGKTPFEHAGFDETDAL
IDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGPCRQLTLHIALRDVRGDSHVA
RLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAYEVYSIDSVHL
VRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAA
HWRLVSHLALNHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGK
PFATFVRGVEIRLAIDDEHFVGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIM
RCKPRSGESILA
NT seq 1839 nt   +upstreamnt  +downstreamnt
atggaagagttgttgccgtattacgaacgcgaactgtcgtttctgcggcgctattcgctc
gaattcgcgaaccgttacccgaagatcgccgcgcgtctcgcccagacgggcgagcagtgc
gaggatccgcacgtcgagcggatgatcgaatcgttcgcgctgctcggcgcgcggatcaac
aagaagctcgacgacgaatatcccgagttcaccgaagcgctcgtcgaagtcctctacccg
cactatctgcggccgttcccgtcatgctcgatcgcgcagttcggtgcgccgcatgcgttc
gcggagctcaccgagccgcggatcgtcgagcgcggcaccgagctgaagagccgcgcgatt
cgcggcgtgcagtgccggttccgcaccgcatacgacgtgacgctcgcgccgatccggctc
gccgatgcgcgctacggatcggtcgcggtggcgcccgccgcagcaaggctgcccggcaac
gcgacgggcgtgatctcgatcgcgttcgaatcgacgtcgccgcagctcgatctcgccgcg
ctgaagctcggcaagctgcgcgcgcatttgcacggcgagcaatcgttcgtcgccgcgctg
gccgattgcctgttcgcgcacgcgctcgcctgctacgtcgagcccgatcgcggcggccgc
tggatcgcgctcggcaagacgccgttcgagcacgcgggcttcgacgagaccgacgcgctg
atcgactatccggcccgttcgcacccggcctatcggctgctgaccgaatacttcgcattc
ccggataaattcaacttcgtcgatttcgatctgggcgcgctcgcgcggcgcgcggggccc
tgccggcagctgacgctgcacatcgcgctgcgcgacgtgcgcggcgattcgcatgtcgcg
cggctgctcgatctgctgagcgcgagccatttccggctcttctgcacgccggtcgtgaac
ctgttccgccagcacggcgagccgattcgggtcgaccaccgggcggtgtcgtacccggtg
atcggcgatgcgcgccgcgcgttcgcgtacgaggtatattcgatcgattcggtgcatctc
gtgcggcagcgcgcggaccgcgaaacgctcgtcgaattccggccgttctattcgctgcat
cacggcgaagccgcgcaggccggccactactggttcgcgcggcgcaacgacgacgtcgcg
cgcaagagccccggctacgagaccgagatttcggtcgtcgacgtcgacttcgagccgggc
gcgccgcaaaccgatacgttgagcctcgatctcacctgtacgaaccgcgacctgccggcc
gcgctcgcgacggggctcgacggcggcgatctcttcatcgacggcggcgagcagcccggc
ccgatcgcgctattgcgccggccgacgccgagcgcgcgcttcgagcgcggccacgccgcg
cactggcgcctcgtgtcgcatctcgcgctcaatcacgtgtcgcttgccgaagaagggctc
gccgcgctgaaggaagcgctcgtgctgtacgatctgaggcgctccgcggtgtcgacgcgc
catatcgacgggatcgtcggcatcgagcagaagagcgcggtgcaatggctgccgggcaag
ccgttcgcgacgttcgtgcgcggcgtcgagatccggctcgcgatcgacgacgaacatttc
gtcggctcgagcctcgcgacgttcgtgcggatgatcgacgcgttcttcgggctgtacgtg
cacctcaacagctttgttcaactgatcgtcgtgtccaggcgcaccggcgaggagatcatg
cgatgcaaaccgcgcagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system