KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3808
Entry
GBP346_A3808      CDS       T00894                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
bpr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GBP346_A3808
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpr02044]
    GBP346_A3808
Secretion system [BR:bpr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   GBP346_A3808
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACQ95337
UniProt: C4KW68
Position
I:complement(3672619..3673122)
AA seq 167 aa
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMV
FTKEIDSSSPLLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHT
EGLPVETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttacacatgcatttgaagttcggtagtcccgccatcaagggcgagtccgccgacaag
gaccacgaaggctggatcgagctgaaatcctgggatcactcgatcgttcagccgcgttcg
gcgaccgcgtcgacggcgggcggccacacggcgacgcgttgcgagcacggcgacatggtg
ttcacgaaggaaatcgattcgtcgagcccgctgctgtatcagcacgcgtcgggcggcacc
acgttcgacgaagtgacgatcgatttcctgcgcgcggacggcgaaggccagcgcgtgaag
tatctcgagatcaagctgaagtacgtgatcatctcgagcatcgcgccgagcgtgcatacc
gaaggcctgccggtcgagaccttctcgctgaagtacgccgcggtccagtggaagcagacg
cagcagaagatcggcggcaaccagggcggcaacacgcagggcgcctggagcctcacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system