KEGG   Burkholderia pseudomallei MSHR346: GBP346_A4267
Entry
GBP346_A4267      CDS       T00894                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpr  Burkholderia pseudomallei MSHR346
SSDB
Other DBs
NCBI-ProteinID: ACQ98667
UniProt: C4KM00
Position
I:4087321..4088286
AA seq 321 aa
MDARWPAYVAPPGVIDWRGRAMPRVCERAGAQRVNERARGGIPCAIFRVRSCMRDSGEQE
RAAHAMSDRRAGQGAAAQTACASRAFGVFRVRVRDRLVSAYIERGCRCRRASRRPCAARM
HTPARPMRARRANCTRCGICVELSRRLIVSRICPTIRFAWLVAAILIPLIKTEGTMPYVS
THYSNNASAPVGRWTCAPTSKLAPFDKAPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQW
RKGAPVKGNATIVAGTVIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVQQ
RRLRWGAHGRSNNGDNFYVVE
NT seq 966 nt   +upstreamnt  +downstreamnt
gtggatgcgcggtggcccgcctacgtcgcgccgcccggcgtgatcgattggcgcgggcgc
gcgatgcctcgcgtttgcgaacgcgccggcgctcaacgggtaaacgaacgagcgcgcggc
ggtattccctgcgcgatattccgcgtgcgctcttgcatgcgcgacagcggcgagcaggaa
cgcgcggcgcacgcgatgagcgaccggcgcgccgggcaaggcgcggctgcgcaaacggca
tgcgcgtcgcgcgccttcggtgtttttcgtgttcgtgtccgcgatcggcttgtgtccgcg
tacattgagcgcggatgccgttgccgtcgcgcatcgcggcggccgtgcgcggcgcgcatg
catacgccggcacggccgatgcgcgcgcgacgcgcaaactgcacgcggtgcgggatttgt
gttgaattgtcgcggcggttgatcgtttcgcgcatctgcccgacaatccggttcgcttgg
ctggttgcagcaattctaattccgcttataaaaaccgagggaaccatgccttacgtgtcg
acccattactcgaacaacgccagcgcgccggtcggccgctggacctgcgcgccgacttcg
aagctcgcgcctttcgacaaggcgccgacgggcagcgtcacgtccggcgtcgatctgtgc
ggccaatgcgtgtcctacgtgaaacgggtctgcccgacgctgccgctcaccgggcaatgg
cgcaagggcgcgccggtgaaaggcaacgcgacgatcgtcgcgggcaccgtgatcgcgacg
ttcaacgccgccggcaagtacgacggccacgcggcgatctacgtcagccagacgaaggac
ggcggcatcctggtgtacgaccagttcgtgacgccgccgacgccgcagccggttcagcaa
cggcgcctgcgctggggcgcgcatggtcggtcgaacaatggggataacttctatgtcgtg
gagtaa

DBGET integrated database retrieval system