KEGG   Beta proteobacterium CB: D521_0151Help
Entry
D521_0151         CDS       T02483                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
bprc  Beta proteobacterium CB
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D521_0151 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB
Motif
Other DBs
NCBI-ProteinID: AGG32721
UniProt: M1SSK3
Position
135853..136227
Genome map
AA seq 124 aa AA seqDB search
MNPHEISITVKTQYLPDQSDPDNRQFAFAYTVTIRNTGTASIQLIARHWFITDGDNDVQE
VRGLGVVGQQPLLRAGEQFEYTSWATLPTPAGTMRGEYFCVTEEAQFFQAPIPEFALVMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctcatgaaatcagcattacggtcaaaacccagtatttgcccgaccagtctgac
cccgataaccgccagtttgcgtttgcctataccgtcaccattagaaatactggtacggct
agcattcagttgattgcacgccattggtttatcactgatggggacaatgatgtccaggaa
gtccgtggcctgggggtggtagggcaacagcctcttttaagggcgggtgagcagtttgag
tacaccagctgggctactttaccaacgccagcaggaaccatgcgtggagagtacttctgc
gttactgaggaggctcagtttttccaggccccaatccctgaatttgccttggtaatgcct
agaaccttgcactag

DBGET integrated database retrieval system