KEGG   Beta proteobacterium CB: D521_0380Help
Entry
D521_0380         CDS       T02483                                 

Definition
(GenBank) transcriptional coactivator/pterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00790  Folate biosynthesis
bprc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D521_0380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprc04147]
    D521_0380
Enzymes [BR:bprc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     D521_0380
Exosome [BR:bprc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D521_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGG32950
UniProt: M1RR42
Position
343192..343494
Genome map
AA seq 100 aa AA seqDB search
MPKPKPLANDFDFAAILPDWQVNLATQELGRTFVFGDFKSAFQFMTLCAHFAEELDHHPD
WSNAWNKVSVSLSTHSMKALTELDITMAKAMDQYALQILA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaacccaaaccccttgcaaatgattttgactttgcagcaatattgcctgattgg
caggtaaatctcgctactcaagagctaggtcggacatttgtatttggggatttcaagagc
gcatttcaatttatgactctatgtgcacactttgctgaggagttagatcaccacccggat
tggtctaatgcttggaataaggtgtcagtgtccttgagcacccattcaatgaaggctttg
accgagctcgacatcaccatggcaaaagccatggatcaatacgcccttcaaatattggct
taa

DBGET integrated database retrieval system