KEGG   Beta proteobacterium CB: D521_0514Help
Entry
D521_0514         CDS       T02483                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00450  Selenocompound metabolism
bprc00970  Aminoacyl-tRNA biosynthesis
bprc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D521_0514
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D521_0514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bprc01007]
    D521_0514
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bprc03016]
    D521_0514
Enzymes [BR:bprc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     D521_0514
Amino acid related enzymes [BR:bprc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   D521_0514
Transfer RNA biogenesis [BR:bprc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D521_0514
 Prokaryotic type
   Other AARSs
    D521_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Zn_Tnp_IS1595 DALR_1
Motif
Other DBs
NCBI-ProteinID: AGG33083
UniProt: M1SM34
Position
complement(475370..477040)
Genome map
AA seq 556 aa AA seqDB search
MSSPKRRLLVTSALPYANGQIHIGHLVEYVQTDIWVRFQRMRGHEVHYVGADDTHGTPIM
LRAEKEGLTPKELIANVWKEHKRDFDDFLISFDNYYTTDSPENEKLSQSIYLKLRDAGLI
EMRSIEQAYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEKCGATYSPTDLKNPFSVVSG
ATPIKKVSDHYFFKLSDPRCETFLREWTQVKTPLQPEARNKMKEWVGQPGDSKLGDWDIS
RDAPYFGFEIPDAPGKYFYVWLDAPIGYYASFLNYCQSKGLNFEEWVKPDTTTEQYHFIG
KDILYFHTLFWPATLHFAGYRTPTNVFAHGFLTVDGEKMSKSRGTLISAHSVIESGFNPE
WFRYYFATKLNDSMEDLDLNLQDFVARVNSDLLGKYINIASRSAGFLVKRFGGVVSDAAM
NNPLLADIASANEKIAELYEAREYAKALRTIMELADKVNAFVDENKPWEIAKAPEREADL
QRVCSITLEAFRLLSLYLKPVLPQVTAGVEDFLSIPTMTWNDVKTPLSSKNPIKPYKHLM
TRVEAPQIEALLAANL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagtagccccaaacgtcgcctgctagttacctccgccctgccttacgccaatggccag
attcatattgggcatttagtggagtatgtccagactgatatttgggtgcgcttccagaga
atgcgtggtcacgaagtacattatgttggcgctgatgacacccacggcaccccgattatg
ttgcgtgccgaaaaagaggggctgactcccaaagagctcattgccaatgtttggaaagag
cataagcgtgactttgatgatttcttaatctcgtttgataactactacaccacagatagc
cctgagaacgaaaaactttctcaaagcatctatctcaaacttcgcgatgcaggcttaatc
gaaatgcgctctattgagcaagcatacgatcccgttaaagagatgttcttgcctgatcgc
tttattaagggagagtgccctaagtgtggcgctaaagatcaatacggtgactcttgcgaa
aagtgtggtgcaacctactccccaactgatctgaaaaacccgttctcagtagtaagcggc
gcaacacccattaaaaaagtttccgatcattacttcttcaagttatccgatccacgttgt
gaaaccttcttacgtgaatggactcaggtaaaaactccgcttcagcctgaagctcgcaat
aagatgaaggaatgggtcggacagcctggagatagtaagcttggggactgggatatctct
cgtgatgccccctactttggctttgaaatccctgatgcgccaggcaagtatttctatgtc
tggcttgatgcgccaattggctattacgccagcttcctcaactactgccagagcaaaggc
ttgaactttgaggaatgggtcaagcccgatacaactaccgagcagtatcactttatcggt
aaagacattctgtatttccacaccctcttttggccggcaactcttcactttgcgggttat
cgcacaccgactaatgtgtttgctcacggcttcctcactgttgatggcgagaagatgagt
aagtcacgcggtactttaatttctgcgcatagcgtgattgaatctggttttaatcctgaa
tggttccgctattactttgcaactaaactcaatgacagcatggaagatttagatttaaat
cttcaagactttgttgctcgagtcaacagcgatttattgggcaagtacatcaacatcgct
agtcgtagcgctggcttcttggtgaagcgttttggcggagtggtttctgatgcagcgatg
aataatccactacttgctgatattgcatctgctaatgaaaaaattgccgagctgtatgaa
gctcgtgaatatgccaaggcattgcgcacgatcatggagttggctgacaaggtcaatgcc
tttgttgatgaaaacaagccctgggaaatcgccaaggctccagagcgtgaggccgactta
caacgggtttgcagtatcactttagaagcattccgtttattaagcctttatctcaaaccg
gtattgccacaagtcacggctggggttgaggacttcctctcgattccaaccatgacctgg
aatgacgttaaaacgcctctctctagcaaaaatccgatcaaaccctataagcacctcatg
acgcgagttgaagcgcctcaaatcgaggctttattagctgcaaacctctaa

DBGET integrated database retrieval system