KEGG   Beta proteobacterium CB: D521_0923Help
Entry
D521_0923         CDS       T02483                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00071  Fatty acid degradation
bprc00072  Synthesis and degradation of ketone bodies
bprc00280  Valine, leucine and isoleucine degradation
bprc00310  Lysine degradation
bprc00362  Benzoate degradation
bprc00380  Tryptophan metabolism
bprc00620  Pyruvate metabolism
bprc00630  Glyoxylate and dicarboxylate metabolism
bprc00640  Propanoate metabolism
bprc00650  Butanoate metabolism
bprc00900  Terpenoid backbone biosynthesis
bprc01100  Metabolic pathways
bprc01110  Biosynthesis of secondary metabolites
bprc01120  Microbial metabolism in diverse environments
bprc01130  Biosynthesis of antibiotics
bprc01200  Carbon metabolism
bprc01212  Fatty acid metabolism
bprc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D521_0923
   00630 Glyoxylate and dicarboxylate metabolism
    D521_0923
   00640 Propanoate metabolism
    D521_0923
   00650 Butanoate metabolism
    D521_0923
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D521_0923
   00072 Synthesis and degradation of ketone bodies
    D521_0923
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D521_0923
   00310 Lysine degradation
    D521_0923
   00380 Tryptophan metabolism
    D521_0923
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D521_0923
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D521_0923
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D521_0923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprc04147]
    D521_0923
Enzymes [BR:bprc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D521_0923
Exosome [BR:bprc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D521_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGG33492
UniProt: M1T3A2
Position
909987..911171
Genome map
AA seq 394 aa AA seqDB search
MSRDVVVLSAVRSAIGAFNGSLSSLEPCELGGIVMKEAVSRSGVDPALINYVTVGNTIPT
DNRYAYVARVASIQAGLPMESVAMALNRLCSSGLQAIVTTAQAIMLGDCDYGVGGGVEVM
SRGMYGSPAMRSGARMGDTKMLDLMVSVLTDPFGVGHMGVTAENLVEKWKLTREEQDALA
VESHRRAAHAIKEGRFKSQIVPITIKTRKGDVVFDTDEHCKPDTTMETLAKMKAVFKKEG
GSVTAGNASGINDGAAFFVLAEAEAAKKAGHKPIARLVSYAIAGVPNHIMGEGPIPATKI
ALERAGLKLDQIDVIESNEAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIA
TKAIHELHRVQGKYALVTMCIGGGQGIATIFERM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgatgtcgtcgttttaagtgcagtacgttctgcaattggtgctttcaatgga
tcactaagcagtcttgagccgtgtgagctcggcggtattgtcatgaaagaagcggtttct
cgctctggagtggatccagccttaattaattacgttactgtgggcaacaccattcctacg
gataatcgttatgcctacgtagctcgtgtggcttctatccaagccggcctcccaatggaa
tcagttgcgatggctttgaatcgtttgtgcagctcaggcttgcaagcgattgtgacaaca
gctcaagcaattatgttgggtgactgcgattacggtgttggcggtggcgttgaagtaatg
tctcgtggcatgtatggttcaccggcaatgcgtagcggtgctcgtatgggtgacaccaag
atgcttgacttgatggtttctgttttgactgatccatttggtgttggtcatatgggtgtt
acggcagagaatctcgttgagaaatggaagctgacccgtgaagagcaagatgctcttgcg
gttgagtctcatcgtcgtgctgcacacgctattaaagaaggtcgcttcaagtctcaaatc
gttccaatcacgattaaaactcgcaagggtgacgtggtgttcgatacagacgaacattgc
aagccagacaccactatggaaactttagcgaagatgaaggccgtcttcaaaaaagaaggt
ggtagtgtcactgcaggtaatgcatctggtatcaacgatggtgctgcgttctttgtattg
gctgaagctgaagccgctaaaaaggctggccataaaccaatcgcccgtttagtctcgtac
gctattgctggcgtacctaaccacatcatgggtgaaggtccaatcccagccaccaagatt
gctcttgagcgcgctggtttgaaattagatcaaattgatgtgatcgaatcgaatgaggcg
tttgctgcacaagccttagctgttaccaaaggcttgggcttggatccagccaagactaac
gtaaacggtggtgcaattgctttgggtcacccaattggttgctctggtgctgcaattgct
actaaagctattcatgagctacatcgcgttcaaggaaaatatgctttggtcacgatgtgt
attggtggcggtcagggtatcgcaactattttcgagcgcatgtaa

DBGET integrated database retrieval system