KEGG   Beta proteobacterium CB: D521_1364Help
Entry
D521_1364         CDS       T02483                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00630  Glyoxylate and dicarboxylate metabolism
bprc01100  Metabolic pathways
bprc01110  Biosynthesis of secondary metabolites
bprc01120  Microbial metabolism in diverse environments
bprc01200  Carbon metabolism
Module
bprc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bprc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    D521_1364
Enzymes [BR:bprc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     D521_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGG33932
UniProt: M1T4J3
Position
complement(1339193..1340491)
Genome map
AA seq 432 aa AA seqDB search
MADRKAEIAALQKDWDTNPRWKGITRGYTAEDVVRLRGSLKIEHTLAKHGAERLWELVNN
EAYVNCLGALTGGQAMQQVKAGVQAIYLSGWQVAADGNSYAAMYPDQSLYPVDSVPKMVE
RINNSFQRADEIQTAKGINKGDPGYIEYFAPIVADAEAGFGGVLNAFELSKALIKQGAAG
VHFEDQLSSVKKCGHLGGKVLLPTSESVQKLISARLAADVMGVSTIILARTDAEAADLLT
SDYDANDKPFLTGERTPEGFYKTRKGLDQAISRGLAYAAYADMVWCETGTPDLEFARQFA
EAIRAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKYQFITLAGIHSMWYNM
FDLAQDYMQRGMTAYIEKVQEPEFAARDRGYTFVSHQQEVGTGYFDDVTTVIQGGKSSVT
ALTGSTEEEQFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgcaaagcagaaatcgcagcattacaaaaagactgggataccaatccacgc
tggaagggtattactcgtggttacacggccgaggacgttgtacgtctccgtggttccctg
aagattgagcacacattggctaagcatggtgcagagcgtctttgggaattggttaacaac
gaggcttacgttaactgtttaggagctttgactggtggacaagctatgcagcaggttaag
gctggcgttcaggcaatctacttgtcaggttggcaagttgctgctgatggtaactcttac
gcggcgatgtatccagaccaatctttgtatccagttgactcagttccgaagatggttgag
cgcattaataactcattccaacgtgctgatgaaattcaaaccgccaaaggtattaacaag
ggtgaccctggctatattgagtacttcgctccaatcgttgctgatgctgaagcaggcttc
ggtggcgtattgaatgcatttgaattaagtaaagcattgatcaagcagggcgctgctggt
gttcacttcgaagaccaattatcttctgttaagaagtgtggtcacttgggaggcaaggta
ttgctgccgacatctgagtcagtgcagaagttgatttctgctcgtttagctgctgacgta
atgggtgtctcaactatcattttggctcgtaccgatgctgaagctgctgacctgttaact
tctgattacgatgcaaatgacaagccatttttgacaggcgagcgcactccagaaggcttt
tacaaaacacgtaagggcttggatcaagcgatttcccgtggtttggcatacgctgcttat
gctgatatggtttggtgtgaaacaggtacgcctgacttggagtttgcccgtcagttcgct
gaagcaattcgtgcgaagttccctggcaagatgttggcctacaactgctcaccatctttc
aattggaagaagaacttggacgatgcaacgattgcgaagttccagcgtgaattaggtgcg
atgggttacaagtatcagttcatcacattggctggtattcactccatgtggtacaacatg
ttcgacttggcacaagactacatgcagcgcggtatgactgcttatatcgagaaagtacaa
gagccagaattcgctgctcgtgatcgtggttatacattcgtatcgcatcagcaagaggtt
ggtactggttacttcgatgatgtaactactgtgattcagggtggcaagtcttcagtaaca
gcattgactggttctacagaggaagagcagttccattaa

DBGET integrated database retrieval system