KEGG   Beta proteobacterium CB: D521_1887Help
Entry
D521_1887         CDS       T02483                                 

Definition
(GenBank) Aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bprc  Beta proteobacterium CB
Pathway
bprc00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bprc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D521_1887
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bprc01007]
    D521_1887
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bprc03016]
    D521_1887
   03029 Mitochondrial biogenesis [BR:bprc03029]
    D521_1887
Enzymes [BR:bprc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     D521_1887
Amino acid related enzymes [BR:bprc01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   D521_1887
Transfer RNA biogenesis [BR:bprc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    D521_1887
 Prokaryotic type
   Other AARSs
    D521_1887
Mitochondrial biogenesis [BR:bprc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D521_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AGG34453
UniProt: M1SR31
Position
complement(1838559..1840358)
Genome map
AA seq 599 aa AA seqDB search
MSMRSHTCGQVTESLIGQEITLSGWVNRRRDHGGVIFIDLRDHQGFVQVVCDPDRPEMFA
LAEQVRNEFCIQIKGLVRARPAGTENNDLVSGKIEVLCHSLVILNASITPPFQLEDENLS
ETTRLTHRVLDLRRPQMQKNLRLRYNVAMECRRYLDAAGFIDIETPMLTKSTPEGARDYL
VPSRVHDGQFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDCETA
FLDELEIRELFENMIRHIFKTTMNVELPNPFPTMPYSEGMARFGSDKPDLRVNFEFTELT
DLMKDVDFKVFSGAANQEGGRVVGLCVPGGAEISRSEIDDYTQFVAIYGAKGLAWIKVNS
VAEGRNGLQSPIVKNLHDAAIEGILKRTGAKDGDIIFFGADKEKVVNDAIGGLRLKIGHS
AWGKEHGLSTEGWKPLWVVDFPMFEYDEDNARWVACHHPFTSPKDEHMQYLESNPGKCLA
KAYDMVLNGSEIGGGSVRIHQEVVQSQVFRALKIGAEEAQAKFGFLLDALQYGAPPHGGI
AFGLDRIVTMMTGAESIRDVIAFPKTQRAQCLLTQAPSPVDERQLKELHIRLRQAAPAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgcgaagccatacctgcggtcaggtaactgaatcacttattggtcaggaaatt
actctctcgggttgggtgaatcgtcgccgtgaccatggtggcgtgatctttatcgactta
cgtgatcatcaaggttttgtgcaggtggtatgcgatccagatcgtccagagatgtttgcc
ttagctgagcaagtccgtaacgagttttgtattcagatcaaaggtttggtgcgtgcgcgt
ccagccggcactgagaacaatgatttggtaagcggcaagattgaagtgctttgccatagc
ttggttattttgaatgcatcgattacacccccgttccaattggaagatgagaatttatct
gaaaccactcgcttaacccatcgcgttctcgatctgcgtcgcccgcaaatgcaaaagaac
ttacgtttgcgttacaacgtggctatggaatgccgtcgctacttagatgcagcaggcttt
attgatattgaaaccccaatgttgacaaagagtactcctgagggtgcgcgtgattacttg
gtgccttcacgtgtacatgatggtcagttctttgccttgccacagtctccccagttgttt
aaacagttgttgatggtggctggctttgatcgttactaccaaattaccaagtgtttccgt
gacgaagatttacgtgctgatcgccagcctgaatttacccagatcgactgtgagacagcc
ttcctcgatgaactagaaattcgtgagctatttgaaaacatgattcgtcatattttcaaa
accactatgaatgttgagttgccaaatccattcccaacaatgccttactcagaaggtatg
gcgcgctttggttcagacaagccagatctgcgtgtgaattttgaattcactgaattgaca
gacctcatgaaagatgtcgatttcaaagtattctctggtgcagcaaatcaagagggtggt
cgtgtagtcggtttatgcgtacctggaggcgctgaaattagtcgtagtgaaattgatgat
tacactcaatttgtagcgatctatggtgccaaaggtttggcgtggatcaaagtgaactcc
gttgctgaaggtcgcaatggtttgcaatcaccaatcgtaaagaacttgcatgatgctgct
atcgaaggcattttgaagcgtactggtgctaaagatggcgacattattttcttcggtgct
gataaagaaaaagtagtcaatgacgctattggtggcttgcgtttaaagattggccattct
gcttggggtaaagagcatggcctctctaccgaaggttggaagccattgtgggtagttgat
ttcccaatgtttgaatacgatgaagacaatgcccgttgggtcgcatgtcaccatccattc
accagccctaaagatgagcacatgcagtatcttgaatctaatccaggcaagtgcttagca
aaagcctatgacatggttctgaacggtagtgagattggcggcggatcagttcgtattcac
caagaggtggtgcagagtcaggtattccgtgcattgaagattggtgctgaagaagcgcaa
gccaagtttggattcctgttggatgctctgcaatatggtgcgcctccgcatggtggtatt
gccttcggtttggatcgtatcgtcacaatgatgactggtgctgagtctattcgcgatgtg
attgccttccctaaaacgcaacgtgcacagtgcttgctcactcaggctcctagcccagta
gatgagcgtcagttaaaagaattgcatattcgtttacgtcaagctgctccagctgcttaa

DBGET integrated database retrieval system