KEGG   Anaerostipes hadrus: CL2_07370Help
Entry
CL2_07370         CDS       T02612                                 

Definition
(GenBank) PTS system, mannose/fructose/sorbose family, IIB component
  KO
K02813  sorbose PTS system EIIB component [EC:2.7.1.206]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00051  Fructose and mannose metabolism
bprl01100  Metabolic pathways
bprl02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CL2_07370
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CL2_07370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bprl02000]
    CL2_07370
Enzymes [BR:bprl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     CL2_07370
Transporters [BR:bprl02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    CL2_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: CBL37771
UniProt: D4MYS6
Position
complement(699670..700158)
Genome map
AA seq 162 aa AA seqDB search
MKINLVRIDDRLIHGQVATVWSKEANAQRIIICSDEVAKDQIRKTLLLQVGPPGVKVSVV
DVAKAVRVYNNPKYEKDTVFFLYTCPQDVLRMAEAGVPIKSVNIGGMAFKTGKTQITKAV
SVDESDIAAFKKLHEMGIELEIRPVATDKKVDLMSKIEGIEG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaatttagtaagaatcgatgacagactgatccatggacaggtcgcaaccgtt
tggtccaaagaagcaaacgcacagcgaatcatcatttgcagtgatgaagtagcaaaagac
cagatccgtaaaacattacttttacaggtgggacctccaggagtaaaagtaagcgttgta
gacgtagcaaaagcagttcgtgtttacaacaatccaaaatatgaaaaggacacagtattc
ttcttatatacatgtccacaggatgttctgcgaatggcagaagcaggggttccgatcaag
agtgttaacatcggaggaatggcattcaagacaggaaagactcagatcacaaaggcagta
tctgttgatgaaagcgatatcgcagcatttaagaaactgcatgagatgggaattgaatta
gagatccgtccggtagccacagacaaaaaagtagatcttatgagcaagatcgaaggcatc
gaaggataa

DBGET integrated database retrieval system