KEGG   Anaerostipes hadrus: CL2_08920Help
Entry
CL2_08920         CDS       T02612                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00564  Glycerophospholipid metabolism
bprl01100  Metabolic pathways
bprl01110  Biosynthesis of secondary metabolites
Module
bprl_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CL2_08920
Enzymes [BR:bprl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CL2_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CBL37910
UniProt: D4MZ65
Position
869691..870563
Genome map
AA seq 290 aa AA seqDB search
MRYADRDGNIYEEENGQDRLLHWMYTTMAGRASLKILIRPWVSKLGGAFLSSPISKCLIK
GFVKNNHIDMSEYEKKNYKSYNEFFSRKIKEGKRPFPEDKTILGSPCDCKVSVYPIEEKT
SFVVKDTRYTLDSLIRNRKIARHFQGGYAVILRLTVDDYHRYCYFDDGIKSENHRIDGVY
HTVNPIANDHVKIYKENTREYTLMKTKHFGDALQMEVGALMVGKIVNHDGAGSMRRGIEK
GYFQFGGSTIILLLEKDKVEIREELLERTKNQCETKIRQGEMIGKALVRP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagatatgccgatagagatgggaatatttacgaagaagagaatgggcaagatcgtttg
cttcattggatgtatacaactatggcaggacgagccagtctaaaaatattaatcagacct
tgggtatccaaactagggggagctttcttaagttctcccatttccaaatgtctgatcaaa
ggatttgtcaagaataatcatattgatatgagtgaatatgagaagaaaaattacaaatct
tataatgaattcttctcaagaaagatcaaagaaggaaaacgtccatttccggaagataaa
acaatcttaggaagtccttgcgattgtaaagtaagtgtgtatccgatcgaagagaagaca
tcttttgttgtaaaggatacaagatatacgttggattcattgatcagaaaccgcaagatc
gcaagacattttcagggcggttatgccgtgatcttacgcctgacagtagatgattatcat
agatactgctattttgatgatggaattaagagtgagaatcataggattgatggagtttat
cataccgtcaatccgatcgcaaatgatcatgtgaaaatctataaagagaataccagagaa
tatacattgatgaagacaaaacattttggagatgcactccagatggaagttggagcattg
atggttggaaagattgttaatcacgatggagccggatctatgaggcgcgggattgagaaa
ggatattttcagtttggaggttcaacgatcattttattattagaaaaggataaggttgag
atcagagaagaactgttagaacgtaccaagaaccagtgtgagacaaagatcaggcagggt
gagatgatcggaaaggcattggtacgaccttaa

DBGET integrated database retrieval system