KEGG   Anaerostipes hadrus: CL2_09460Help
Entry
CL2_09460         CDS       T02612                                 

Definition
(GenBank) monosaccharide ABC transporter ATP-binding protein, CUT2 family (TC 3.A.1.2.-)
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CL2_09460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bprl02000]
    CL2_09460
Enzymes [BR:bprl01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     CL2_09460
Transporters [BR:bprl02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    CL2_09460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 SMC_N AAA_13 AAA_22 MMR_HSR1 AAA_23 AAA_15 DLIC Dynamin_N AAA_30 AAA_27 AAA_25
Motif
Other DBs
NCBI-ProteinID: CBL37959
UniProt: D4MZB4
Position
921909..923426
Genome map
AA seq 505 aa AA seqDB search
MSDEKKTVLSMRHINKTFPGVKALSDAQLTLREGEIHALMGENGAGKSTLIKVLTGVEEF
ETGEIIMDGKSIINTSPQEAGNNGISTVYQEVNLCPNLTVAENIFIGREPMKMGRIDWKT
MNTQAQKILDNLELEIDATQELENYSVAIQQMVAIARAVDIQSKVLILDEPTSSLDEGEV
EKLFKVMNMLKKRGTAIVFVTHFLEQVYAVCDRITVLRNGHFVGEYKTEELPRFKLVATM
MGKEFDDLADIKGSGTSSKKQSDEVVIEAKGLYHKGTIKPFDIKIHKGEVVGLSGLLGSG
RSELVRAIYGADKPDGGELYVKGEKLDVKAPIDAMHQGMAYCPEDRKVEGIIADLSVREN
MILALQAKRGMFKLMSRKEQEELTDKYIKMLQVKTASRETPIKSLSGGNQQKVILGRWLM
TEPDFLILDEPTRGIDVGTKTEIQKLVVKLANEGMSVVFISSEVEEMLRTVTHMGILRDG
EKVGELEESELSQENVMKAIAGGDK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgaaaagaagacagttctatccatgcgacatattaataaaacattcccagga
gtgaaagcactgtccgatgcacagcttacattgagagaaggagagattcatgccttaatg
ggagaaaatggtgcaggaaaatctacactgatcaaagttcttacaggagttgaggaattt
gagacaggtgagatcatcatggatggaaaaagtattattaacacatcccctcaagaagcg
ggaaacaatggaatcagcaccgtttatcaggaagtaaacttgtgtccgaatctaacggta
gcagaaaatatctttatcggaagagaaccaatgaaaatggggaggatcgactggaagacg
atgaatacacaggcacagaagatccttgataatctggaattagaaattgatgccacacag
gaattggaaaactattccgtagcgattcagcagatggtggcgatcgcaagagcagttgac
attcagtcaaaagtattgatccttgatgaaccaacatcaagtcttgatgaaggagaagtt
gagaaattatttaaggttatgaatatgctaaagaaacgcggaacagcgatcgtatttgta
acacactttttggaacaggtctatgcagtctgtgacaggatcacagtacttagaaatgga
cattttgtaggcgaatataagacagaagagcttccaagatttaaattagttgcaacaatg
atgggaaaagaatttgatgatctggcagacatcaaaggaagtggaacatcatcaaagaaa
caaagcgacgaagttgtgatcgaagcaaaaggtctttatcataaaggaacgatcaaacca
tttgacattaagatccataaaggagaagttgttggattatctggattattaggatctgga
cgttccgaacttgtaagagcgatttatggagcagataaaccagatggaggagaattatat
gtcaaaggagaaaaattagatgtcaaagcaccaattgatgcaatgcatcaaggaatggca
tattgtccggaagatcgtaaagtagaaggaatcattgcagatctttctgtaagagaaaac
atgatcttggcacttcaggcaaaacgaggaatgttcaaactaatgagcagaaaagaacag
gaagagttgacagataagtatattaagatgctgcaggttaagacagcaagcagagaaaca
ccgatcaaatcattaagtggtggtaatcagcagaaagtaatcctcggaagatggctgatg
acagaaccagatttcctgatccttgatgaaccaaccagaggtattgatgttggaacaaag
acagagattcagaaattagtcgtaaaacttgcaaatgaaggaatgtctgttgtatttatt
tcatccgaagtagaagaaatgcttcgtaccgtgactcacatgggaatcttacgagatggt
gagaaagtcggagaattggaagaaagtgaattatcacaggaaaatgtaatgaaagcaatc
gcaggaggtgacaaataa

DBGET integrated database retrieval system