KEGG   Anaerostipes hadrus: CL2_10520Help
Entry
CL2_10520         CDS       T02612                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00071  Fatty acid degradation
bprl00280  Valine, leucine and isoleucine degradation
bprl00310  Lysine degradation
bprl00362  Benzoate degradation
bprl00380  Tryptophan metabolism
bprl00620  Pyruvate metabolism
bprl00630  Glyoxylate and dicarboxylate metabolism
bprl00640  Propanoate metabolism
bprl00650  Butanoate metabolism
bprl00900  Terpenoid backbone biosynthesis
bprl01100  Metabolic pathways
bprl01110  Biosynthesis of secondary metabolites
bprl01120  Microbial metabolism in diverse environments
bprl01130  Biosynthesis of antibiotics
bprl01200  Carbon metabolism
bprl01212  Fatty acid metabolism
bprl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CL2_10520
   00630 Glyoxylate and dicarboxylate metabolism
    CL2_10520
   00640 Propanoate metabolism
    CL2_10520
   00650 Butanoate metabolism
    CL2_10520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CL2_10520
   00072 Synthesis and degradation of ketone bodies
    CL2_10520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CL2_10520
   00310 Lysine degradation
    CL2_10520
   00380 Tryptophan metabolism
    CL2_10520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL2_10520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CL2_10520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CL2_10520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bprl04147]
    CL2_10520
Enzymes [BR:bprl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CL2_10520
Exosome [BR:bprl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL2_10520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF3147
Motif
Other DBs
NCBI-ProteinID: CBL38050
UniProt: D4MZK5
Position
1047873..1049057
Genome map
AA seq 394 aa AA seqDB search
MAKKVVIAGACRTAIGKMGGVLSTVPAVDMGSIVIKEALKRAGVPADQVDHVYMGCVIQA
GLGQNVARQASLNAGLPIETPAVTVNVVCGSGLNCVNMAAQMIQAGDADIVVAGGMESMS
MAPFALPKARFGYRMNNGTLVDTMVNDALTDAFNHYHMMITAENVAEQWGLTREELDEFA
AASQQKAVAAQESGRFKDEIVPVEVKQRKKTVIVDTDEGPRPGTTAESLAGLRCCSGKEG
GVVTAGNASGINDGAAAVVVMSEEKAKELGVTPMATYVTGALGGVDPSIMGVGPVASTKK
ALAKADLTIDDMDLIEANEAFAAQSVAVARDLKFDMSKVNVNGGAIALGHPVGASGCRIF
VTLLHEMQKRDAKKGLATLCIGGGMGCTTIVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagtagttatcgcaggagcatgccgtacagcgattggtaaaatgggtgga
gtactcagcacagtaccagcagtagacatgggatcaatcgtaatcaaagaagcattaaag
agagcaggagttccagctgatcaggtagaccatgtatacatgggatgcgttatccaggca
ggattaggacagaacgttgctcgtcaggcttccttaaacgcaggacttccaattgaaaca
ccagcagttacagttaacgtagtatgtggatcaggattaaactgtgtaaacatggcagca
cagatgattcaggcaggagatgctgatatcgttgttgccggtggtatggaaagcatgtca
atggctccatttgcattaccaaaagcacgtttcggatatcgtatgaataacggaacactg
gtagatacaatggttaacgatgcattaacagatgcattcaatcactatcacatgatgatc
acagctgaaaacgtagcagaacagtggggattaactcgtgaagaattagatgagtttgca
gcagcttctcagcagaaagcagtcgcagctcaggaatcaggaagattcaaagatgagatc
gttcctgtagaagtaaaacagagaaagaaaacagttatcgtagatacagacgaaggacca
agacctggaacaacagctgaatctttagcaggattaagatgctgctctggaaaagaaggt
ggagttgttacagctggtaacgcatcaggaatcaacgatggtgcagcagcagtcgtagta
atgagcgaagaaaaagccaaagaattaggtgttacaccaatggctacatatgtaacagga
gctcttggtggtgtagatccatctatcatgggtgttggaccagtagcttctacaaagaaa
gctttagcaaaagcagacttaacaattgacgatatggacttaatcgaagcaaacgaagct
ttcgcagcacagtctgtagcagtagcaagagatctgaaattcgatatgagcaaagtaaac
gtaaacggtggagcaatcgctcttggacatccagtaggagcttcaggatgccgtatcttc
gttacactgcttcatgaaatgcagaagagagacgctaagaaaggtcttgcaacactttgc
atcggtggtggaatgggttgcacaactatcgttgaaagagactaa

DBGET integrated database retrieval system