KEGG   Anaerostipes hadrus: CL2_21080Help
Entry
CL2_21080         CDS       T02612                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00220  Arginine biosynthesis
bprl01100  Metabolic pathways
bprl01110  Biosynthesis of secondary metabolites
bprl01130  Biosynthesis of antibiotics
bprl01230  Biosynthesis of amino acids
Module
bprl_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CL2_21080
Enzymes [BR:bprl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CL2_21080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CBL38983
UniProt: D4MUB7
Position
2087160..2088113
Genome map
AA seq 317 aa AA seqDB search
MDAKTSLKGRSFLTLKDFTPEEIGYFLDLAAKLKADKKKGITGNSLKGKNIALLFEKPST
RTRCSFTIGCVDEGAHPEYLGKDDIQLGHKESVEDTARVLGRMFDGIEFRGFLHENVEKL
AKYSGVPVWNGLTDDYHPTQILADFLTLREQFGEIKGLNFVFAGDGRNNMSNSLMIGCSK
MGLNFTCLAPKSLWPNEELVKQCEEYAKESGAKIRFTEDVKEAVEGADCIYTDVWASMGE
EDKAAERIALLRPYQVNKEMLEMTGKDTTVVMHCLPAVKGHEITEDVFEHYADVIFDEAE
NRMHTIKAVMVATLGEY
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaagacaagcttaaagggaagaagtttcttaacattaaaagactttacacca
gaagaaattggttattttttagatttagcagcgaaattaaaagcagataagaaaaaaggg
atcacaggaaacagtctaaaagggaaaaatatcgctcttttatttgaaaaaccaagtaca
agaacaagatgttcatttacgatcggatgtgttgatgagggtgcacacccagaatatcta
ggaaaagatgatattcagttaggacacaaagaatctgtagaagatacagcaagagttctt
ggaagaatgtttgacgggatcgaatttcgtggattcttacatgagaacgtagagaaatta
gcaaaatacagtggagttccagtatggaatggtttaacagatgattaccatccaacacag
atcttagcggacttcttaacattaagagaacagtttggagagatcaaaggattaaacttt
gtattcgctggagacggaagaaataacatgagcaactctttaatgatcggatgcagtaag
atgggattgaatttcacatgcttagcaccaaagagtttatggccaaatgaagaactggta
aaacagtgcgaagagtatgcgaaagaatctggagctaagatccgttttacagaagatgtg
aaagaagctgtggaaggtgcagactgcatttacacagacgtatgggcatctatgggtgaa
gaagacaaggcagcagaaagaattgctttattaagaccatatcaggtaaataaagagatg
ttagagatgacaggaaaagatactacagttgttatgcattgcctgccagcagttaaagga
catgagatcacagaagatgtttttgaacattatgcagatgtgatttttgatgaagcagaa
aatcgtatgcacacgatcaaagctgttatggtagcgactttaggagaatattag

DBGET integrated database retrieval system