KEGG   Anaerostipes hadrus: CL2_24860Help
Entry
CL2_24860         CDS       T02612                                 

Definition
(GenBank) Glycerol dehydrogenase and related enzymes
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
bprl  Anaerostipes hadrus
Pathway
bprl00561  Glycerolipid metabolism
bprl00640  Propanoate metabolism
bprl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bprl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CL2_24860
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CL2_24860
Enzymes [BR:bprl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CL2_24860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CBL39331
UniProt: D4MVB5
Position
complement(2478211..2479281)
Genome map
AA seq 356 aa AA seqDB search
MRKYYPNYSIGTDAYADIPMVCEKYGTKAVIIGGTHALAAAADLIKEAVADSNIMITGVF
EYGGEASREHIDELNSHQEVIDADMIFACGGGKAIDTCKVLSQESNRPFFTFPTIASTCA
SCTSLGIIYHPDGSLREYSFQEKPSEWIFINTQVIANAPEKYLWAGIGDTMAKFYECTTS
ARGDNDLDHSTSMGVQISNLCARPLVKYGVEALEECRNHTPGKTLEEVILGIIVSTGFVS
NLVGIDLNTGLAHACYNGFTVCKSTEEHGHLHGEIVAYCILILLKVDHQEEEFKKIYEFS
KNMGFPVKLADIHATIDDMDAVITKALSGIDVRVWPYEVTPDMILDAVKEIEQVAL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatactacccaaattactccattggaaccgacgcatatgccgacatccctatg
gtatgtgaaaaatacggaacaaaagctgtgatcatcggaggaacacatgccttggctgcc
gctgccgatctgatcaaagaagctgttgctgacagcaatatcatgatcaccggtgtcttt
gaatacggtggtgaagccagtcgtgaacacatagatgaattaaattctcatcaagaagtt
attgatgctgatatgatctttgcatgtggtggcggaaaagcgattgatacttgtaaagta
ttgtcacaggaaagcaaccgaccattctttacatttccaacgattgcttctacttgtgct
tcttgtacatcacttggtatcatctatcatccagatggttcccttcgtgaatattctttc
caggagaaaccttctgaatggatctttatcaatacacaagtgatcgccaatgctcctgaa
aagtacctgtgggctggaattggtgatacaatggctaaattttatgaatgtacaaccagt
gcccgtggtgataatgatctagaccatagcacttccatgggcgtccagatcagtaatctt
tgtgccagaccattagtaaaatacggtgtagaagccttagaagaatgtcgaaatcatact
cctggaaaaactctggaagaagtcattcttggaattatcgtttctactggttttgtatca
aatcttgtcggaattgatttaaataccggacttgcacatgcctgctataacggatttact
gtatgtaaatctaccgaagaacatggacatctgcatggtgagatcgttgcttattgtatc
ctgatcttattaaaagttgatcatcaggaagaggaatttaagaaaatctatgaattctcc
aagaatatgggatttcctgtgaaacttgcggatattcatgcgacgattgatgatatggat
gctgtgatcacaaaggctttatctggaattgatgtacgtgtatggccttatgaagtaact
cctgatatgatccttgatgctgtaaaagagatcgagcaagttgctttataa

DBGET integrated database retrieval system