KEGG   Blautia producta: PMF13cell1_01289Help
Entry
PMF13cell1_01289  CDS       T05894                                 

Gene name
metG_3
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bpro  Blautia producta
Pathway
bpro00450  Selenocompound metabolism
bpro00970  Aminoacyl-tRNA biosynthesis
bpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PMF13cell1_01289 (metG_3)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PMF13cell1_01289 (metG_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpro01007]
    PMF13cell1_01289 (metG_3)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpro03016]
    PMF13cell1_01289 (metG_3)
Enzymes [BR:bpro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PMF13cell1_01289 (metG_3)
Amino acid related enzymes [BR:bpro01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PMF13cell1_01289 (metG_3)
Transfer RNA biogenesis [BR:bpro03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PMF13cell1_01289 (metG_3)
 Prokaryotic type
   Other AARSs
    PMF13cell1_01289 (metG_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind Anticodon_1 tRNA-synt_1f tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: QBE95765
UniProt: A0A4P6LVH8
Position
complement(1390901..1392871)
Genome map
AA seq 656 aa AA seqDB search
MDRKKYYITTAIAYTSGKPHIGNTYEAVLADSIARFKRQQGYDVFFQTGTDEHGQKIEMK
AEEAGVTCKEFVDRVSGEIKNIWDMMNTSYDKFIRTTDDYHEKQVQKIFKKLYDQGDIYK
GHYEGMYCTPCESFFTESQLVDGKCPDCGRPVTPAKEEAYFFKMSKYAQRLIDHINEHPE
FIQPVSRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDPKHVVYVWLDALTNYITGIGY
DCDGDSTEQFKKDWPADLHLIGKDIIRFHTIYWPIFLMALDLPLPKQVFGHPWLLQGDGK
MSKSKGNVIYADQLVDFFGVDAVRYFVLHEMPFENDGVITWELMVERLNSELANTLGNLV
NRTISMSNKYFGGVVSSTGVTEPVDEELKAVVLGTKKKVADKMEELRVADAITEIFALFK
RCNKYIDETMPWALAKDESKKDRLAEVLYNLVEGICIGASLLESFMPETTEKILSQLNAS
KRTYEELDTFGSYPSGSKVTEKPEILFARLDVKEIMEKVEAMRAAEAAANAPEEETEEEK
PVVDIEAKPEVTFDDFMKMQFQVGEIISCEEVKKSKKLLCSQVKIGSQVKQIVSGIKASY
KPEDMVGKKVMVLVNLKPAKLAGILSEGMILCAEGLDGELALMTPDKDMPAGAEIC
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaaaaaatattatatcaccacagcgattgcctacacctcaggcaaaccgcac
attggcaacacctatgaggctgttctggctgacagcatcgccagatttaaaagacagcag
gggtacgacgtgttcttccagacaggaactgatgagcatggacagaagatcgagatgaaa
gcagaggaagcaggtgtaacctgtaaggaatttgtggaccgggtatccggggagatcaag
aatatctgggacatgatgaacacatcctatgacaagttcattcgtaccacagatgactat
catgagaaacaggtacagaagattttcaaaaagctgtatgaccagggtgatatctataaa
gggcattatgaggggatgtattgtactccatgtgaatcctttttcacagaatcccagctt
gtggacggaaaatgtccggactgcggacgcccggtgactccggccaaagaggaagcgtat
ttctttaaaatgagcaaatatgcccagcggcttatcgaccatatcaatgaacacccggaa
ttcatccagccggtttccagaaaaaatgagatgatgaacaacttcctgctcccgggactt
caggacttgtgcgtgtccagaacctccttcaaatggggaatcccggtagattttgacccg
aagcatgtggtgtatgtgtggctggacgccctgaccaactatatcaccggaatcggatat
gattgtgacggggatagcacagagcagtttaagaaagactggcctgcagacctgcacctg
atcggcaaggacattatccgtttccataccatttactggccgattttcctgatggctctt
gatctgcctcttccgaaacaggtatttgggcatccatggcttttacagggggatggcaag
atgagcaaatccaaaggaaacgtcatttatgcagaccagcttgtggacttcttcggagtg
gatgctgtgcgttactttgtgctccacgaaatgccatttgagaacgatggtgtcatcacc
tgggagcttatggtggaacgcctgaattccgagctggcaaacactctgggcaatctggta
aaccgcactatctctatgtctaacaaatatttcggcggagtggtatccagtacaggtgtg
accgagccggttgatgaggaattaaaggcagttgtccttggcacaaagaaaaaagtagcg
gacaagatggaggaacttcgcgtggcagatgccatcacagagattttcgcccttttcaaa
cgctgcaacaaatatattgatgaaactatgccgtgggcactggcaaaagacgagagcaaa
aaagaccgtctggcagaagtactttacaatctggttgaaggtatctgcatcggagcgtcc
ctgctggaatctttcatgcctgagacaacagagaagatcctctctcagttgaatgcgtca
aagagaacctatgaggagttggataccttcggttcctatccttcaggcagcaaagtgaca
gagaaaccggaaattctcttcgcccgcctggatgtcaaagagatcatggagaaagtggaa
gctatgcgtgccgctgaggcagcagcaaacgcaccggaggaagagacagaggaagaaaag
cccgttgtggatatagaagcgaaaccggaagtgacatttgatgattttatgaaaatgcag
ttccaggtgggagagatcatttcctgtgaggaagtgaaaaaatccaaaaaactcctttgc
tcccaggtgaagatcggaagccaggtgaaacagatcgtctccggtatcaaagccagctat
aagccggaagacatggtaggcaaaaaagtaatggttttggtaaacctgaaaccggcaaaa
ctggccgggatcctgtcagaaggcatgatcctgtgtgcggaggggctggatggtgaactg
gcgcttatgacaccggataaggatatgccggccggagctgagatctgctga

DBGET integrated database retrieval system