KEGG   Blautia producta: PMF13cell1_02721Help
Entry
PMF13cell1_02721  CDS       T05894                                 

Gene name
cysS
Definition
(GenBank) Cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bpro  Blautia producta
Pathway
bpro00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bpro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PMF13cell1_02721 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bpro01007]
    PMF13cell1_02721 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpro03016]
    PMF13cell1_02721 (cysS)
Enzymes [BR:bpro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     PMF13cell1_02721 (cysS)
Amino acid related enzymes [BR:bpro01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PMF13cell1_02721 (cysS)
Transfer RNA biogenesis [BR:bpro03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PMF13cell1_02721 (cysS)
 Prokaryotic Type
    PMF13cell1_02721 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 UVR Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QBE97168
Position
3079847..3081253
Genome map
AA seq 468 aa AA seqDB search
MKIYNTLTKRKEDFIPLEEGKVKMYVCGPTVYNFIHIGNARPMIVFDTVRRYMEYKGYEV
NYVSNFTDVDDKIIAKAIEEGVPAEEISERYIKECKKDMADMNVKPATTHPLATQEIDGM
IQMIQTLIDKGFAYAVNGTVYFRVKNFKEYGKLSHKNLDDLQSGFRSIQVSGEDQKEDPL
DFVLWKPKKEGEPYWVSPWSEGRPGWHIECSVMSKKYLGEEIDIHAGGEDLVFPHHENEI
AQSECCNGKIFAKYWMHNAFLNIDNRKMSKSLGNFFTVREIGEKYDLQVLRFFMLNAHYR
SPLNFSAELMEASKNALDRIVTCVDQLKHLLESAQGEELSQSEKAMLPEIEGLVKKYEES
MEDDFNTADAIAAVFELVKFTNTQVDGSSTKAFAELLFDKITGLCDVLGLMVNKKEEVLD
SVIESLIEERQAARKAKDFARADEIRDQLASMGIILKDTREGVQWKRA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttacaatacactgacaaagaggaaagaagattttattcccttagaggaagga
aaagtaaaaatgtatgtgtgcggaccaaccgtatacaattttatccatataggaaatgca
aggcctatgatcgtatttgacactgtcagaagatatatggagtataaaggatatgaggta
aattacgtatccaatttcacagatgtggatgataagatcattgcaaaagccatcgaggaa
ggggttcccgcagaggagatttctgagcgctatatcaaggaatgtaaaaaagatatggct
gatatgaatgtaaagcccgccaccacacatcccctggcaacccaggaaattgatggtatg
atccaaatgatccagactctcattgacaagggttttgcctatgcggtgaatggtacggta
tatttcagagttaagaatttcaaggagtacggtaagttgtctcacaagaatctggatgac
ctgcagtcaggatttcgttccatccaggtatcaggagaggaccagaaggaagatcctctg
gattttgttctgtggaagccgaaaaaggaaggggagccttactgggtatcaccctggagc
gaaggaaggccgggctggcatattgagtgctctgtcatgtcaaaaaaatacctgggtgag
gagattgacatccatgcaggcggcgaggatctggtatttccccatcatgagaatgagatc
gcccagtctgagtgctgcaatggaaaaatttttgcaaaatactggatgcacaatgcgttc
ctgaatattgataatagaaaaatgtcaaaatctctggggaatttctttactgtccgtgag
atcggcgagaaatatgacctgcaggttctgcgctttttcatgctgaacgcccattacaga
agtcccctcaacttcagtgcagagctgatggaggcatccaagaatgcactggaccgtatt
gtgacctgtgtggaccagctaaaacatctccttgaaagtgcccagggtgaggagctttcc
cagtcagagaaagcaatgcttccggagattgaagggcttgtgaagaagtatgaggagtcc
atggaggatgatttcaatacggcagatgccatcgcagccgtttttgaacttgtaaaattc
acgaatactcaggtggacggcagcagcaccaaagcatttgcggaactgctctttgataag
atcacaggcctgtgtgatgtgcttgggctgatggtgaataaaaaggaagaggtccttgac
tctgtgatagaaagcctgatcgaagagcgccaggctgccagaaaggcaaaggattttgcg
cgtgcagacgagatccgtgaccaactggcctccatgggcatcattttaaaagacacaaga
gaaggtgtacaatggaagagagcttaa

DBGET integrated database retrieval system